Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001611001
Length(AA) : 399
Localization : scaffold_113
Number of EST contigs matching the gene: 1
Number of ESTs : 18
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_15244
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001805401.1| Score: 706 E_value: 2e-72
KEGG Definition: hypothetical protein
Accession: ncr:NCU03207.1 Score: 682 E_value: 6e-70
KOG Definition: Ran GTPase-activating protein
Classification: [RNA processing and modification
Kog Number: KOG1909 Score: 795 E_value: 2e-85
PFAM Definition: No Hit Found
Swissprot: P41391|RNA1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0031965 = Cellular component: nuclear membrane
GO:0005098 = Molecular function: Ran GTPase activator activity
GO:0030702 = Biological process: chromatin silencing at centromere
GO:0007059 = Biological process: chromosome segregation
GO:0051383 = Biological process: kinetochore organization and biogenesis
GO:0006913 = Biological process: nucleocytoplasmic transport
GO:0031291 = Biological process: Ran protein signal transduction
GO:0007346 = Biological process: regulation of mitotic cell cycle

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.040NO0.069NO0.038NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2380.0510.761_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04574First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001611001
MSSKVFILKSRDGKPLKLDTAADIEPHIASLEGNETVEEIRLCGHTFGIK
ACKALAEVLKTNKNLQVFNAADIFTGRLISEIPDALSALLTALLTLEHLH
TVDLSDNAFGGRLADTLGDFYARAGPLRHLLLNNNGLGPAGGIIVANSIR
QLAVLKASTPAYPPLETIVCGRNRLENGSMAAWAEAYAAHKSLRTVKMVQ
NGIRQEGISALLRDGLSKNHGLQTLDLQDNTFTAAGAYALAAVVTNWSDL
LELGVGDCLLSARGGVLLGEALGLGKNKALKTIRLQYNEIDVKGVEAIKR
AINPSLPKLQRLELNGNKFSEDELVVEQMREIFGDRGFGELDSLSDMEEE
TDEEDEEDESDEGEDVVKQAEEAEDAKVPQEKDKKVDALADLLDGAKIA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1176 hypothetical protein SNOG_15244 [Phaeosphaeria nodorum SN15]3e-72


Manual Annotation:

Please find below the necessary files for GSTUMT00001611001 annotation :

link to GSTUMT00001611001 Artemis file
link to scaffold_113 sequence file
link to scaffold_113ESTs