Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001515001
Length(AA) : 442
Localization : scaffold_111
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : TmelRAR1  [+]

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE59296.1| Score: 1148 E_value: 1e-123
KEGG Definition: mevalonate kinase MVK/ERG12 [EC:2.7.1.36]; K00869 mevalonate kinase
Accession: aor:AO090023000793 Score: 1148 E_value: 1e-124
KOG Definition: Mevalonate kinase MVK/ERG12
Classification: [Lipid transport and metabolism].
Kog Number: KOG1511 Score: 832 E_value: 1e-89
PFAM Definition: GHMP_kinases_C, GHMP kinases C terminal. This family includes homoserine kinases, galactokinases and mevalonate kinases..
Pfam Number: pfam08544 Score: 115 E_value: 2e-06
Swissprot: P07277|KIME_YEAST
Gene Ontology:
GO:0004496 = Molecular function: mevalonate kinase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.259NO0.700NO0.208NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0940.10.779_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=5.29876First60=2.62774PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001515001
MVSAPGKVIVYGEHAVVYGKAAIAAALSLRSYLLVTPLPKTSRTLSLNFS
DISLNHSWDIDSLPWAIFSKPGKKRYYFDTVERLDKELLETVKPLVAAIP
GKVQQGAASAFLYLYLMLGSKHAPASIYTLRSAIPIGAGLGSSASISVCL
STALQLQMGTLATPFEGMLSNETQLQLKRINNWSFVGEMCIHGNPSGVDN
TVATGGRAVLFKRTDYSLPPEVTHLRNFPELPLLLVDTKQPRRTAEQLAN
VRNMLNAHPEITQSMLDTIDRITAEAHDVISDPDFTSFSGSPSLSRLGEL
IRINHGLLVSLGVSHPKLERIRELIDHTGIGWTKLTGAGGGGCSITLLKP
KVKANILEELDSKLRTEGFEKYQTTLGGDGVGVLWPAVVGDAETEITQEM
FLGVEGMKGVEALVGVGAIGKGIRGWRFWREWIAEGSDFCLH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4519 unnamed protein product [Aspergillus oryzae]8e-61


Manual Annotation:

Please find below the necessary files for GSTUMT00001515001 annotation :

link to GSTUMT00001515001 Artemis file
link to scaffold_111 sequence file
link to scaffold_111ESTs