Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001453001
Length(AA) : 432
Localization : scaffold_112
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE57760.1| Score: 220 E_value: 5e-16
KEGG Definition: predicted protein
Accession: aor:AO090003000596 Score: 220 E_value: 3e-16
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.102NO0.283NO0.117NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2220.0810.685_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00072First60=0.00072PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001453001
MFNRLPIYTRPKEPAIGYPVLIESTNQTLTGLPSSQIVGFPQYLGGSSAL
RNSNESAFKGPSEKPVLSLNAGSHQSLYDDDLAPPPPLRINTLQYPSPPG
SSNSNRTVGPGSNKQLNIPNHTMNAPPRKLNITRKPAPSSFSGANPTHST
HSTHSSDTFIASGLDKAATIDFSSSSSSHVQPRGRGFGLGNVVKGKVASR
KRHDSDFGAESPIPIAAVKPPNFVSIDDWLDSREREGLHRRSNTVSTVAT
QVPRYNDPIKLHLRQSTFAPLAPPTEMSLNDSPAVPSIPAQYLPAPRSDS
IRAVSAPLPPHEIHPIQRPASVPKDEPQEPKDHLSQLEFEQDQLTMRRAA
LRREIYDLEQVLPPNPSTHNPVARREMQARRDQLVQDLADVEKDLHEMGM
KLHRAWRRRDKKMGTEGPTHLWVSRVTGSGDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1048 unnamed protein product [Aspergillus oryzae]9e-16
SY0AAC4YO03FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00001453001 annotation :

link to GSTUMT00001453001 Artemis file
link to scaffold_112 sequence file
link to scaffold_112ESTs