Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001450001
Length(AA) : 393
Localization : scaffold_112
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN4960.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_662564.1| Score: 213 E_value: 3e-15
KEGG Definition: hypothetical protein
Accession: ani:AN4960.2 Score: 213 E_value: 1e-15
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.096NO0.157NO0.063NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.40.0590.655_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00018First60=0.00018PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001450001
MNTPPRLRSRGRPKTPPTPRHGPMFSSPEPQRTGKRKGTSSMSNYSTATL
SPPPSSPIAPRSPDQTRTVKGKKRATFAIEGAAGASSSEIDSDGDKGGSA
GREEQDDEIEKILGKNRKTLLNPGGFGLPTPAKTPSRKRKHLDLEEIAGS
ARVLFPSSSKSRASSSTSLSCARRTLFKKPSSRQRKGGMGSLDLLGDERP
ASDSISIFTDSNARIPKHDDDPDNPFISRPGEESVTSKRQRIKKKKKAGS
LGADEDREDGMVYVFRGKKIFKKFTEMEDPNERLPNIEESTSSQPATSFT
EALAAMGKQKELAEKRDISRLTPDSEDDSGHSSIFNPGNKTASKRRSIFD
AAGDGDELVTAPVKKNLRRKRGLENGSATLESPRRARGKRARV

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB11YI11FM1 No hit found
SY0AAC44YB13FM1 hypothetical protein NCU04742 [Neurospora crassa OR74A]1e-07


Manual Annotation:

Please find below the necessary files for GSTUMT00001450001 annotation :

link to GSTUMT00001450001 Artemis file
link to scaffold_112 sequence file
link to scaffold_112ESTs