Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001336001
Length(AA) : 70
Localization : scaffold_279
Number of EST contigs matching the gene: 7
Number of ESTs : 42
  User annotation : No user annotation

Blast Results:

Nr Definition: No Hit Found
KEGG Definition: predicted protein
Accession: mgr:MGG_06201 Score: 90 E_value: 2e-04
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.065NO0.529NO0.068NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0450.1160.951_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03312First60=0.02277PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001336001
MPSYIITVKPETSDSELLKIKDDIVAQGGSRANSLLTRFPPWRLIDMCRA
WRLMARLLLSSGALFGPDNE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6338 hypothetical protein FG01960.1 [Gibberella zeae PH-1]1e-14
Contig6468 hypothetical protein FG01960.1 [Gibberella zeae PH-1]7e-15
Contig6566 hypothetical protein FG01960.1 [Gibberella zeae PH-1]1e-14
Contig7549 hypothetical protein FG01960.1 [Gibberella zeae PH-1]1e-13
SY0AAB31YF16FM1 hypothetical protein FG01960.1 [Gibberella zeae PH-1]3e-10
SY0AAC38YL08FM1 hypothetical protein FG01960.1 [Gibberella zeae PH-1]3e-06
SY0AAD49YP12FM1 hypothetical protein FG01960.1 [Gibberella zeae PH-1]9e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00001336001 annotation :

link to GSTUMT00001336001 Artemis file
link to scaffold_279 sequence file
link to scaffold_279ESTs