Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001325001
Length(AA) : 360
Localization : scaffold_277
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE61123.1| Score: 319 E_value: 1e-27
KEGG Definition: predicted protein
Accession: aor:AO090102000007 Score: 319 E_value: 7e-28
KOG Definition: Rac1 GTPase effector FRL
Classification: [Signal transduction mechanisms
Kog Number: KOG1923 Score: 111 E_value: 4e-06
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.053NO0.158NO0.054NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4260.0390.497_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.39729First60=0.00912PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001325001
MAVCTVFFGRQSRDERIVKESTKIYTRALAQLNAALSNKTMHTRDETLAA
TMLLGMYETMGCADPLTWQRHADGMELLVRVRGPEAHTTELGHRLFTSFR
GTSLTNSLVSCKRNFLASKEWLTIPWTKTQKTPMQQLQDLHLELPGILEA
RRALPRSAHPSLLRRCLDFKAKLEAWYENFISTPSAHHWLEFSALNIDPP
VFPTCYRFPNIGVANTYTFYWANLIVLNYTIIGLTPACQSPLVTTDEIYD
LAAQICMSVEYFVAPERKSYGPVLTMYPLRVATGCFMRMGARGKKSTLWC
KAIFGVLGERGVMLAKMLEMVVWENKETEEAESVGTVHEWAKKEFWGRVE
EGLDEPETEM

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB4YI13FM1 predicted protein [Coccidioides immitis RS]2e-06
SY0AAB50YC23FM1 conserved hypothetical protein [Aspergillus fumigatus A1163]1e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00001325001 annotation :

link to GSTUMT00001325001 Artemis file
link to scaffold_277 sequence file
link to scaffold_277ESTs