Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001304001
Length(AA) : 511
Localization : scaffold_275
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG03920.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_384096.1| Score: 1241 E_value: 1e-134
KEGG Definition: hypothetical protein
Accession: fgr:FG03920.1 Score: 1241 E_value: 1e-134
KOG Definition: Predicted transporter (major facilitator superfamily)
Classification: [General function prediction only].
Kog Number: KOG0254 Score: 557 E_value: 1e-57
PFAM Definition: Sugar_tr, Sugar (and other) transporter..
Pfam Number: pfam00083 Score: 569 E_value: 5e-59
Swissprot: P53048|MAL11_YEAST
Gene Ontology:
GO:0005624 = Cellular component: membrane fraction
GO:0005352 = Molecular function: alpha-glucoside:hydrogen symporter activity
GO:0005364 = Molecular function: maltose:hydrogen symporter activity
GO:0015574 = Molecular function: trehalose transmembrane transporter activity
GO:0015771 = Biological process: trehalose transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.017NO0.045NO0.016NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0790.0910.916_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=227.129First60=4.61928PredHel=10
Topology=(103-122,132-154,161-183,188-210,291-313,323-345,352-374,384-406,417-439,454-476)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001304001
MDANPASLSGEDVKGASSGQLDLDVTQHTLFEEANRYDHNQTFREALRDE
KGVLLWAGVMGAAALSWGFDAQVNGAAISVEAFRRDFGYIYEGKAVLPAN
WQTIFNVTSTVGAFFGGLASGYIADRVGRKWCAWLGSWILCAGIALEIAA
TTRAVFTVAKVILGVALGFYLSVAPAYCSEISPVVLRGITTCGVSLAIVV
GQLLSNVAIKIFGERLDRWAYRGPFCVHPHGTWYARVTSRELALLSFGIL
HGTDRDIAPRLAQIQETLRLENELYTNAAWLDCFKGVDARRTMITVGVFC
CQHLSGIIFVLGYSTYFFQLAGLPTSQTFSLGVGVTACGVAGNISSWWLV
NTVGRRIVAFYGMVVLTGMLTLIGVFDVIPTAGAQWAQSAFTVIYSYVWF
LTIGAMGYVILGEASSSRLRSKSVGLAAVVQSLWGLIMNFALPYFVNPDE
ANLRGKVGFIFGGTSLLATVWVFFCVPEFKGLTFSEIDERFKMRVPARKF
QEYKGRPESDG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3409 hypothetical protein AN7866.2 [Aspergillus nidulans FGSC A4]2e-47
Contig3789 hypothetical protein FG03920.1 [Gibberella zeae PH-1]1e-84


Manual Annotation:

Please find below the necessary files for GSTUMT00001304001 annotation :

link to GSTUMT00001304001 Artemis file
link to scaffold_275 sequence file
link to scaffold_275ESTs