Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001263001
Length(AA) : 112
Localization : scaffold_268
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: prefoldin subunit 4
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001548837.1| Score: 261 E_value: 1e-21
KEGG Definition: hypothetical protein; K09550 prefoldin subunit 4
Accession: ani:AN0862.2 Score: 251 E_value: 9e-21
KOG Definition: Molecular chaperone Prefoldin
Classification: [
Kog Number: KOG1760 Score: 284 E_value: 5e-27
PFAM Definition: Prefoldin_2, Prefoldin subunit. This family includes prefoldin subunits that are not detected by pfam02996..
Pfam Number: pfam01920 Score: 207 E_value: 4e-18
Swissprot: P53900|PFD4_YEAST
Gene Ontology:
GO:0016272 = Cellular component: prefoldin complex
GO:0015631 = Molecular function: tubulin binding
GO:0007021 = Biological process: tubulin folding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.034NO0.053NO0.024NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0880.0730.904_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001263001
MDMTANSFSTLHQKQGLLKDELEKKSQEKEYIEDVSNELELADDDDLIPY
KIGDSFLHLPLEEVMQLLEANKEEVGKGVEEIVEKMEANEVVMSSLKVEL
YAKFGKAINLEV

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB13YL24FM1 prefoldin subunit 4 [Botryotinia fuckeliana B05.10]9e-13


Manual Annotation:

Please find below the necessary files for GSTUMT00001263001 annotation :

link to GSTUMT00001263001 Artemis file
link to scaffold_268 sequence file
link to scaffold_268ESTs