Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001206001
Length(AA) : 219
Localization : scaffold_265
Number of EST contigs matching the gene: 4
Number of ESTs : 38
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_03136
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_360593.1| Score: 1062 E_value: 1e-114
KEGG Definition: hypothetical protein; K02866 large subunit ribosomal protein L10e
Accession: mgr:MGG_03136 Score: 1062 E_value: 1e-114
KOG Definition: 60s ribosomal protein L10
Classification: [Translation
Kog Number: KOG0857 Score: 784 E_value: 2e-84
PFAM Definition: Ribosomal_L16, Ribosomal protein L16p/L10e..
Pfam Number: pfam00252 Score: 250 E_value: 2e-22
Swissprot: Q09127|RL10A_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.112NO0.229NO0.077NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3350.0170.808_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00299First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001206001
MARRPARCYRYCKNKPYPKSRFNRGVPDPKIRIFDLGRKRAGVDEFPLCV
HLVSNEYEQLSSEALEAARICANKYLVKIAGKDGFHMRVRAHPFHVIRIN
KMLSCAGADRLQTGMRGAWGKPNGTVARVNIGQIILSVRTRDTHRATAIE
ALRRSQYKFPGRQKIIVSKNWGFTPLRRDEYLEKRRAGGVKVDGAYVQFL
RPHGQLEDNMRRFPEAFAA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2661 hypothetical protein MGG_03136 [Magnaporthe grisea 70-15]1e-114
Contig7438 conserved hypothetical protein [Chaetomium globosum CBS 148.51]4e-61
SY0AAB28YA15FM1 ribosomal L10 protein [Paracoccidioides brasiliensis]4e-89
SY0AAD43YD13FM1 hypothetical protein MGG_03136 [Magnaporthe grisea 70-15]1e-57


Manual Annotation:

Please find below the necessary files for GSTUMT00001206001 annotation :

link to GSTUMT00001206001 Artemis file
link to scaffold_265 sequence file
link to scaffold_265ESTs