Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001134001
Length(AA) : 167
Localization : scaffold_254
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : MANTUM00001134001  [+]

Blast Results:

Nr Definition: ubiquitin conjugating enzyme Ubc3
Specie: [Schizosaccharomyces pombe 972h-]
Accession: ref|NP_595778.1| Score: 665 E_value: 2e-68
KEGG Definition: ubcp3; hypothetical protein [EC:6.3.2.19]; K04555 ubiquitin-conjugating enzyme E2 G2
Accession: spo:SPBP16F5.04 Score: 665 E_value: 1e-68
KOG Definition: Ubiquitin-protein ligase
Classification: [Posttranslational modification
Kog Number: KOG0426 Score: 750 E_value: 1e-80
PFAM Definition: UQ_con, Ubiquitin-conjugating enzyme. Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine..
Pfam Number: pfam00179 Score: 502 E_value: 7e-52
Swissprot: O00102|UBC7_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0030466 = Biological process: chromatin silencing at silent mating-type cassette

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.046NO0.153NO0.058NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1830.050.806_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00016First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001134001
MSFAAANKRLLKEYKALLKESPEGIAAGPIDESNLFEWECLIQGPEETPF
EGGVFPATLSFPKDYPLNPPKMKFTCEMFHPNVYKDGTVCISILHSPGDD
PNQYEDASERWSPIQSVEKILISVMSMLAEPNDESGANIDASKIWRDDRK
EYEKRVRACARRALGLF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2622 ubiquitin conjugating enzyme Ubc3 [Schizosaccharomyces pombe 972h-]4e-68
SY0AAA55YI10FM1 ubiquitin-conjugating enzyme E2-18 kDa [Ajellomyces capsulatus NAm1]8e-56


Manual Annotation:

Please find below the necessary files for GSTUMT00001134001 annotation :

link to GSTUMT00001134001 Artemis file
link to scaffold_254 sequence file
link to scaffold_254ESTs