Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001080001
Length(AA) : 299
Localization : scaffold_247
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CC1G_06049
Specie: [Coprinopsis cinerea okayama7#130]
Accession: gb|EAU92062.1| Score: 279 E_value: 4e-23
KEGG Definition: conserved hypothetical protein
Accession: tva:TVAG_026090 Score: 262 E_value: 2e-21
KOG Definition: 26S proteasome regulatory complex
Classification: [
Kog Number: KOG4412 Score: 252 E_value: 1e-22
PFAM Definition: No Hit Found
Swissprot: P57078|RIPK4_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.081NO0.277NO0.092NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1870.0760.813_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.07197First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001080001
MESLPREILVHIAKHAPPRDINSLLQTNRTFSTLLNTTLLDSAVDRDYPD
AAQRALYTFAQREDDESVLRLLRRGILDIIGKDRVLHEAIEKEPEIVVCN
LWRNGAKLRTRGDQGRTPIMIAAKQGYTEAVRMMMADKDLDINEQDQWLR
TALYLAAGEGNESVVEALMSHPDIDPNTTDQFGDTPLHVAVECGWSEIVA
LLLSSPKTLINAKDARNMAPLHIAIALEYLDVVKLLLRDPRLRVNERANS
YQTALYMAASQGQTQIVRTLLRYPDVDAASSNGPGRGGNGIPDANIPDD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig5429 hypothetical protein CC1G_06049 [Coprinopsis cinerea okayama7#130]2e-23
SY0AAD53YI04FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00001080001 annotation :

link to GSTUMT00001080001 Artemis file
link to scaffold_247 sequence file
link to scaffold_247ESTs