Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001032001
Length(AA) : 304
Localization : scaffold_241
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: guanine nucleotide-binding protein beta subunit
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001551314.1| Score: 1456 E_value: 1e-159
KEGG Definition: hypothetical protein
Accession: mgr:MGG_04719 Score: 1445 E_value: 1e-158
KOG Definition: G protein beta subunit-like protein
Classification: [Signal transduction mechanisms].
Kog Number: KOG0279 Score: 1206 E_value: 1e-133
PFAM Definition: WD40, WD domain, G-beta repeat..
Pfam Number: pfam00400 Score: 126 E_value: 6e-08
Swissprot: Q01369|GBLP_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.195NO0.435NO0.159NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0860.0920.845_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02901First60=0.00089PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001032001
MVLRGTLEGHSDWVTALATSLENPNMLLSASRDKTLIIWNLTRDSDTGYG
VPKRSLKGHSHIVSDCVISSDGAYALSASWDRTLRLWELSTGQTTRRFVG
HDNDVLSVSFSADNRQIVSGSRDRTIKLWNTLGDCKFTITDKGHTDWVSC
VRFSPNPQNPVIVWELASCRIQTDHTGHTGYINTVTISPDGSLCASGGKD
GTTMLWDLNESKHLYSLNAGNEIHALVFSPNRYWLCAATATSIIIFDLEK
KSKVDELRPDFIPIGKKRREPECVSLAWSADGQTLFAGYTDNLIRAWGVM
SRAM

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1521 G-protein comlpex beta subunit CpcB [Neosartorya fischeri NRRL 181]1e-124
SY0AAB29YL14FM1 hypothetical protein SNOG_06484 [Phaeosphaeria nodorum SN15]7e-90


Manual Annotation:

Please find below the necessary files for GSTUMT00001032001 annotation :

link to GSTUMT00001032001 Artemis file
link to scaffold_241 sequence file
link to scaffold_241ESTs