Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001007001
Length(AA) : 857
Localization : scaffold_245
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CHGG_05813
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001221908.1| Score: 518 E_value: 4e-50
KEGG Definition: hypothetical protein
Accession: ncr:NCU06252.1 Score: 511 E_value: 1e-49
KOG Definition: Dual specificity phosphatase
Classification: [Defense mechanisms].
Kog Number: KOG1716 Score: 228 E_value: 3e-19
PFAM Definition: DSPc, Dual specificity phosphatase, catalytic domain. Ser/Thr and Tyr protein phosphatases. The enzyme's tertiary fold is highly similar to that of tyrosine-specific phosphatases, except for a "recognition" region..
Pfam Number: pfam00782 Score: 234 E_value: 6e-20
Swissprot: O13453|PMP1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0017017 = Molecular function: MAP kinase tyrosine/serine/threonine phosphatase activity
GO:0005515 = Molecular function: protein binding
GO:0006470 = Biological process: protein amino acid dephosphorylation
GO:0000749 = Biological process: response to pheromone during conjugation with cellular fusion
GO:0032005 = Biological process: signal transduction during conjugation with cellular fusion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.143NO0.327NO0.152NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2010.1670.694_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.001First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001007001
MVEELFLFAAPSSSCVSPRSHSESGTTMTSRETDTPSLKRTFTRVSRSYP
PSPADRQDPQKPFETTTPTQQSNLSQRMSLSLKRRYPFCKSPSAPTSIVY
DVPTPAVPSFVSIFDPDVDMSGCSPTKVTSQFSHPILTSAVKPTMPRVPA
GPISLQHPSLQHPIHQQNNSVSTSASSSTNSSPTTTISTVESAITEDHTP
ESSPDSSVRAVPLSSFRSTTMSSDDYSIVPPSPLPGCGRSISPSKKPRNT
KNLSLNVPPPPAQSSAQPNTQVNQPSPRSMSAPTSPAFIKPPPPAQNPRR
RPSNLGLTIKLPGSLPEKSAVRGPLAGGVSVLRHHQSSPSLLSPGPNGIP
GGMRLPLTPGFRQPRLFQPRHSFNSCNARDALSTSPSSSTTNSPPKSPEV
LHEMDEEDEEPRSGEAKSPAYPSGPVCIFDPNIYLYAEPDAELASQFDVI
VNVAREVVNPFKTDKNLTAAKAALGANCKDAESDSLPPDTACTEASFTTA
FEEALFSPVLASSRRPKLDALGPKHKQPEYVHMLWDHNTPILDDLPHLVN
LINDRASAGKKVLVHCQCGVSRSATLLIAYAMFKSPEKTMQDAYNAVKGR
SKWIGPNMSLIYQLTDWKKKIASDNSQPVMAGWRGGGAGSAGGRGHTKVD
TRGGFGRAGPSDGPGMSESIPEPQTAPLPVCRNSPSSLPLDTCMGQSGDH
PIPQMVRTRSENGGFISGVSPGPSSAPPGMITIPGASDISFKRQSWPEKI
STPLSERADSPLALWGMGASEKSRVGSVPPLLQSSAYLVQCEEIYGRDAG
SGDDDLPPPPPNFTSPRSSTYFPVPMRRSGNFSIFTDPRSPTQRGETPIV
RSIFDVL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7408 hypothetical protein SNOG_11864 [Phaeosphaeria nodorum SN15]2e-15
SY0AAD9YE14FM1 hypothetical protein NCU06252 [Neurospora crassa OR74A]3e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00001007001 annotation :

link to GSTUMT00001007001 Artemis file
link to scaffold_245 sequence file
link to scaffold_245ESTs