Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000979001
Length(AA) : 411
Localization : scaffold_238
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_01067
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_368177.1| Score: 716 E_value: 2e-73
KEGG Definition: hypothetical protein [EC:2.5.1.-]; K06125 4-hydroxybenzoate hexaprenyltransferase
Accession: mgr:MGG_01067 Score: 716 E_value: 7e-74
KOG Definition: Para-hydroxybenzoate-polyprenyl transferase
Classification: [Coenzyme transport and metabolism].
Kog Number: KOG1381 Score: 802 E_value: 4e-86
PFAM Definition: UbiA, UbiA prenyltransferase family..
Pfam Number: pfam01040 Score: 444 E_value: 1e-44
Swissprot: P32378|COQ2_YEAST
Gene Ontology:
GO:0032592 = Cellular component: integral to mitochondrial membrane
GO:0005792 = Cellular component: microsome
GO:0005739 = Cellular component: mitochondrion
GO:0008412 = Molecular function: 4-hydroxybenzoate octaprenyltransferase activity
GO:0005515 = Molecular function: protein binding
GO:0006744 = Biological process: ubiquinone biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.321NO0.591NO0.221NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.910.0220.155M212

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=176.993First60=0.00011PredHel=7
Topology=(173-195,200-217,224-246,251-273,294-316,320-339,351-373)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000979001
MAVRFPRLGMRSLSQAIYQINRTPSRLSPRNLTTVTRPSSILRHKPLPNV
ISRINTTTATTTPPTSQIPPEIYEPPKSGLLSHFPRKTIPYAELIRLDKP
TGTIYLFLPCLWSTLLAGTLTDPVTPLPTVLGTTFLFATGALIMRGAGCT
INDLLDRNIDLHVSRTKFRPIARGAITPFNALAFTCVQLLAGLAVLVQFP
AQTIIWGIPSLAVVTVYPLMKRATHYPQFVLGLAFSWGALLGFPALGLGL
DGPVMATAACLYGSNVAWTVVYDIVYAHQDVRDDVKAGVKSIVVKHEAYT
KYLMSALGAAQVGLLASAGAVAGCGPVFYLVSCGGAAGSLAYMIRKVNLK
DVKECWYYFEWCAWAVGFFAVGGGLFGEYMAVRSGLYGGEGLWGLGGSRH
RAFQRVQNKDG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1368 hypothetical protein MGG_01067 [Magnaporthe grisea 70-15]1e-66


Manual Annotation:

Please find below the necessary files for GSTUMT00000979001 annotation :

link to GSTUMT00000979001 Artemis file
link to scaffold_238 sequence file
link to scaffold_238ESTs