Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000968001
Length(AA) : 237
Localization : scaffold_238
Number of EST contigs matching the gene: 1
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_00587
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_368657.2| Score: 145 E_value: 1e-07
KEGG Definition: hypothetical protein
Accession: mgr:MGG_00587 Score: 145 E_value: 5e-08
KOG Definition: RNA binding protein RBM12/SWAN
Classification: [General function prediction only].
Kog Number: KOG4307 Score: 113 E_value: 2e-06
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.033NO0.055NO0.025NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1190.0590.871_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000968001
MSIRFGRSGNGYDSSEVMETEDDDWRKVTDLNERRKIQNRLAQRNYRRKL
RQRLEELERQAGKNSGPSTSVSNKKRPKQPTSGAGTVSETSARGRANSGP
RRGESSHAPHGVVDTEGRFSTIDSLLSPPSVSGESEDSSASASSRGIYTS
DFSPMLLRPTARSSENTYPVWQNQSQLQYPEPPSYSSSQPYIASTSEYPP
TSSVPAPSVSPAPTHQQLQAFEYEQYLSTQCPPNYQY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4243 hypothetical protein MGG_00587 [Magnaporthe grisea 70-15]3e-07


Manual Annotation:

Please find below the necessary files for GSTUMT00000968001 annotation :

link to GSTUMT00000968001 Artemis file
link to scaffold_238 sequence file
link to scaffold_238ESTs