Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000935001
Length(AA) : 326
Localization : scaffold_234
Number of EST contigs matching the gene: 3
Number of ESTs : 12
  User annotation : No user annotation

Blast Results:

Nr Definition: CORD and CS domain protein
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_752520.1| Score: 871 E_value: 1e-91
KEGG Definition: CORD and CS domain protein
Accession: afm:AFUA_1G11540 Score: 871 E_value: 6e-92
KOG Definition: Zn2+-binding protein Melusin/RAR1
Classification: [
Kog Number: KOG1667 Score: 564 E_value: 1e-58
PFAM Definition: CHORD, CHORD. CHORD represents a Zn binding domain. Silencing of the C. elegans CHORD-containing gene results in semisterility and embryo lethality, suggesting an essential function of the wild-type gene in nematode development..
Pfam Number: pfam04968 Score: 248 E_value: 5e-22
Swissprot: Q7T3F7|CHRD1_DANRE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.182NO0.300NO0.107NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0870.1130.859_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00367First60=0.0015PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000935001
MTQKCAHKGCGKTFTDPEEECHYHPGAPIFHEGQKGWQCCKTRVLTFDEF
LTIPPCSVGKHSVDAPILAPVQTSGPGSQQQKHPEVAPPPEIGSDGTEVY
GQPQPLQRKALPKVGAASGTPPPEKKEKPLEQDDPSVPAPPGARCRRLGC
EATYDGGSREDEDEKCEFHPGVPIFHEGSKGYSCCKRRVLEFDQFLKIPG
CATDRHLFVGAPKPGDDEELVSCRNDFYQTYTDVIVSIFAKKVDKTRAEV
HFSEKQLDVDLPMPDNKRYKVSFPLYGAIDPAGCEYKVLTTKIELKLKKA
DGLSWPTLRSDEVSGEIIQIGKPATA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2215 CORD and CS domain protein [Aspergillus fumigatus Af293]1e-57
SY0AAA26YG05FM1 CORD and CS domain protein [Aspergillus fumigatus Af293]4e-29
SY0AAB43YG04FM1 unnamed protein product [Aspergillus oryzae]2e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00000935001 annotation :

link to GSTUMT00000935001 Artemis file
link to scaffold_234 sequence file
link to scaffold_234ESTs