Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000896001
Length(AA) : 200
Localization : scaffold_232
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU00218
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_956603.2| Score: 732 E_value: 6e-76
KEGG Definition: ADP-ribosylation factor family protein; K07943 ADP-ribosylation factor-like 2
Accession: afm:AFUA_1G14970 Score: 729 E_value: 7e-76
KOG Definition: GTP-binding ADP-ribosylation factor-like protein ARL2
Classification: [Intracellular trafficking
Kog Number: KOG0073 Score: 579 E_value: 9e-61
PFAM Definition: Arf, ADP-ribosylation factor family. Pfam combines a number of different Prosite families together.
Pfam Number: pfam00025 Score: 574 E_value: 4e-60
Swissprot: Q2TA37|ARL2_BOVIN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.112NO0.509NO0.103NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4730.0620.481_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00553First60=0.00224PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000896001
MLAILRKSRLKDQEMRVLMLGLDNAGKTTIVKHVMGEDVRTVSPTLGFII
KTIDYKGYVQSGMWDVGGQKTLRSYWRNYFEKTDSLIWVVDATDRFRLGD
CRTELHGLLQEERLLGASLLVFANKTDVSGCMAEPEITQGLNLNDIKTHK
WAIFSCSAITGKNISEGLDWVVGDAQERLFLYNGLGGDLATANTVKGQLN

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB61YK15FM1 hypothetical protein ATEG_00851 [Aspergillus terreus NIH2624]6e-22
SY0AAD63YH01FM1 hypothetical protein FG06640.1 [Gibberella zeae PH-1]6e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00000896001 annotation :

link to GSTUMT00000896001 Artemis file
link to scaffold_232 sequence file
link to scaffold_232ESTs