Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000876001
Length(AA) : 288
Localization : scaffold_228
Number of EST contigs matching the gene: 2
Number of ESTs : 89
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_15203
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001805361.1| Score: 336 E_value: 1e-29
KEGG Definition: hypothetical protein
Accession: yli:YALI0B07601g Score: 290 E_value: 1e-24
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.888YES0.997YES0.622YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0560.9520.019S130

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=89.3752First60=21.8063PredHel=4
Topology=(4-26,150-172,182-204,228-250)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000876001
MRFSAIVPIALSIAAFILSMLVLFAGRNNGFLGDTYVTKIDTSNLNVSNT
GISALDNILDSAAQDIVNTTASRLGLHDFYKVFIMNYCEGERDSNDNERI
TNCTKQKGMFTFNPVGVFERELLQGVTLRDLGVNTQDLDTAINVLKVAYR
TMFVTYCIGITAAGIAIILGFLGFIESRLIACSNWMFAVISFLFLGVASG
IGTTTGVKIRDAINREMGGIGVRAYISKRYLGMTWAAVICMLIVTFFWCG
ACFSRRKNRTHHKSADENQLAGSGPVGKKKRSWRRWGH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1394 hypothetical protein SNOG_15203 [Phaeosphaeria nodorum SN15]2e-29
SY0AAA55YM23FM1 hypothetical protein SNOG_15203 [Phaeosphaeria nodorum SN15]4e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00000876001 annotation :

link to GSTUMT00000876001 Artemis file
link to scaffold_228 sequence file
link to scaffold_228ESTs