Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000846001
Length(AA) : 387
Localization : scaffold_227
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: serine/threonine protein kinase
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_747273.1| Score: 1148 E_value: 1e-123
KEGG Definition: serine/threonine protein kinase, putative [EC:2.7.11.1]; K08856 serine/threonine kinase 16
Accession: afm:AFUA_8G04670 Score: 1148 E_value: 1e-124
KOG Definition: Serine/threonine protein kinase/TGF-beta stimulated factor
Classification: [Transcription
Kog Number: KOG2345 Score: 786 E_value: 2e-84
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 347 E_value: 2e-33
Swissprot: Q12003|KP236_YEAST
Gene Ontology:
GO:0000329 = Cellular component: membrane of vacuole with cell cycle-correlated morphology
GO:0042802 = Molecular function: identical protein binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.571YES0.780NO0.434YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1270.5030.217S417

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.21152First60=0.21091PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000846001
MAQYFLDLVYSLTTCMSCFPSSPNLTINHRSFKILRLLGEGGFSYVYLVQ
DNAGALYALKKIRCPFGQESVQRAMKEVEAYKLFNHENVIKSVDYTITSD
RSASTTLGRSDDGDDGSQKTVYILLPYFRRGNLQDAINANLINHTIFPEG
RLMRLFLGVCRGLQALHEHRLKRPGEVRAGAGATAGGGSDETTEPLMTPD
VLSTQEGGQEGDIRAYAHRDIKPGNVMIDDDGLRPILMDFGSMTPAPTPI
TSRTLALSVQDNAAEHSTMPYRAPELFDVKTGSVIDEKVDIWSMGCTLYC
ALYGDSPFELATEESGGSLALAVCSGSYTFPEEGRLGGRKPGQRPVSEGV
KEIVRMCLKVEPADRPNIRELIREVERVIETSGEGEE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4259 serine/threonine protein kinase, putative [Aspergillus clavatus NRRL 1]9e-75


Manual Annotation:

Please find below the necessary files for GSTUMT00000846001 annotation :

link to GSTUMT00000846001 Artemis file
link to scaffold_227 sequence file
link to scaffold_227ESTs