Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000793001
Length(AA) : 1079
Localization : scaffold_223
Number of EST contigs matching the gene: 3
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_09584
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001589862.1| Score: 2240 E_value: 0.0
KEGG Definition: conserved WD40 repeat-containing protein
Accession: aor:AO090120000302 Score: 2171 E_value: 0.0
KOG Definition: Conserved WD40 repeat-containing protein
Classification: [Function unknown].
Kog Number: KOG0308 Score: 1004 E_value: 1e-109
PFAM Definition: No Hit Found
Swissprot: Q09731|YA4E_SCHPO
Gene Ontology:
GO:0000935 = Cellular component: barrier septum
GO:0051285 = Cellular component: cell cortex of cell tip
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.079NO0.235NO0.061NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1010.0840.868_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00719First60=0.00057PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000793001
MESITGTALYRSPQVMPCADGMGLDEFEFQRLSRSVSPVPPPIPSPTIPP
FSHLWYRCCSLFRFTAHTVQRALSPLASPTSRLYPTAPPPPYLSMARKAR
QRISYILPLANSPGGHRLGVNSLAVDKQGILYSAGRDGAVCSWKIGVDLA
DGAANSAAIPRPAPPPSTFFTQAQAHTHWVNDLALCHSNAALVSASSDLT
VKLWRPHAADQLPPETIGVHSDYVKCLATPDEHSDWVASGGLDRKIMIWD
LNGGGEKLQIDVGDEGTNPKGSIYSLGIGGGIIASGGPESVVRVWDPRSG
QRITKFVGHTDNVRSILVSQQGNIILTASSDTTIKMWSLTAGRCIHTLSM
HNDSVWSLYSSHPNLDIFHSSDRSGLVAKTDVRNVDEIEEGICVAVCQDQ
EGVNKVVACGDYLWTATQSSSINRWLDVDTNTDIGPDPRRPRLSTTSAFP
SNVRDPDAVTVYSIPNARQASISETILDADPGVLVPVNDLPDETIEGQHG
LIKHFLLNDRRRVLTLDTAGEVMMWDLLKCMPVKSFGKRHLEDVAAEVNT
VESVANWCQIDTRTGRLACVLEENYCFDAEMYADEADIEDAVEFRDDQRI
NLGKWVLRYLFSNLINEEIARDEDYRKRLDSDREEREQMRRTNAPPQISM
PPVTFSSDIGTQSPGGASVATPKAHNGFSLFPQTPGMVIGLATPALTLAP
SNIAHAGEAAPLPTTNEEESGPRASLSPTTRGSIDKLATGDYFSTGSTSN
ATPTKPISSGPSLGEAVDDAPATPSTADKEKEEKDSSLLGRWRSFGTRKL
GRSASTDTANKPTVSTVDEKPSGDESAISDKPDPLEDTLLGVLKKIRGSY
EIQVRERVGEPFRSSIAPSLPLETPVLKPPGNTTIIIQEDRLDFGGVADL
YRGTVSCVGEDADLLEKVAPAWLGDLILLNRIPLKDTVKVSFVLIPWQDK
LPQLPSDEGKNSRLNANRMLRAKKIAAYVAERLEPPFMTTSFSPEIKEGQ
NPPKPEDWLELLCHDQIVPPAMTLATIRSYVWKAHGDVVLHYRRRDGAGV
SPASSTTAVEVEKDSNGEEGAVDNVSTVR

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB10YH06FM1 hypothetical protein SS1G_09584 [Sclerotinia sclerotiorum 1980]6e-35
SY0AAB57YF13FM1 hypothetical protein SS1G_09584 [Sclerotinia sclerotiorum 1980]1e-44
SY0AAC57YG13FM1 hypothetical protein SS1G_09584 [Sclerotinia sclerotiorum 1980]2e-57


Manual Annotation:

Please find below the necessary files for GSTUMT00000793001 annotation :

link to GSTUMT00000793001 Artemis file
link to scaffold_223 sequence file
link to scaffold_223ESTs