Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000673001
Length(AA) : 507
Localization : scaffold_211
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU02399
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_959719.2| Score: 207 E_value: 2e-14
KEGG Definition: hypothetical protein
Accession: ncr:NCU02399.1 Score: 207 E_value: 1e-14
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.560YES0.934YES0.385NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3130.2720.283M5115

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=4.67924First60=4.53125PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000673001
MCCVFTLRLPFPILAPLHHKNHNSPSPITNSAYLLSRPAVRFLPIALATM
FCNWAAVAATSIRGRDRSPSSGPEIKPPVPFTGPKIFPRYSPPQTSGSSF
TAPPQERSFYTFFGRIKKATEVTPEHLNALGVLVEYDVPVEKLLPSGGAS
FIPVDDDKIFSERRRELLIPNDDAVEALARRRKDVKLGHMYRFYQGVDMV
KTYYPTEPPSDPLTPMSSGDEAGKNGKRKAEEVVEGGVEKKGKPEGPSAT
APTPLSDLPEINEEEDGRKFSMPEKFREELVKNFIEPICWGYGVRIYQSP
PRAPPRVALQRSRFLVHMTNYIYLTPALPAEARSGLVEGPVMGVQVRHEF
EFLKKQSDDSMDVDGEEEVGDVVGITREVAAALSIAQDRRKGPREGRPEG
KTEKKIRFRAVGKDDKWRDDIFLLTSLHHHISITHISVTQPYLRFLETGQ
MPNLNHEYFQTEEGNDWDKLKVQKTRFWDLLDPEERTEAGRSFSGVLAWL
SRNEPKR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3836 No hit found
Contig6608 hypothetical protein NCU02399 [Neurospora crassa OR74A]1e-09


Manual Annotation:

Please find below the necessary files for GSTUMT00000673001 annotation :

link to GSTUMT00000673001 Artemis file
link to scaffold_211 sequence file
link to scaffold_211ESTs