Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000639001
Length(AA) : 708
Localization : scaffold_206
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU08945
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_960812.1| Score: 895 E_value: 5e-94
KEGG Definition: hypothetical protein
Accession: ncr:NCU08945.1 Score: 895 E_value: 3e-94
KOG Definition: 3'-5' exonuclease
Classification: [Replication
Kog Number: KOG2248 Score: 396 E_value: 8e-39
PFAM Definition: Exonuc_X-T, Exonuclease. This family includes a variety of exonuclease proteins, such as ribonuclease T and the epsilon subunit of DNA polymerase III..
Pfam Number: pfam00929 Score: 142 E_value: 2e-09
Swissprot: Q4WYA1|REXO3_ASPFU

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.272NO0.621NO0.218NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1680.2390.417_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00955First60=0.00231PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000639001
MFRPLPLWKSIPCPAIKSGSACSLPHCLFSHSMVPAPAIISSLSSPALPS
TQSPAKKEASPSSSPRPPTVPTPTPVQPNVSIAKDPRIIASARNAAPPSA
NRKRRMATGDEDSYASSSSDGGVPLGTGPAPPAPKKIKTDAARAGSAAPI
APKPKSILRAHAKVNSQTPSSTFKPNAQAQNSPKPKTHSKARAEDTSKSV
PVPRGAGGASAQTTAQPSATGSTASGAPKAGIAKPATSGKPLSLNPRLVA
AAPATHDIRLRLLTLLHKEYVRLHEHKGDEQLMLRYALDEEETLAVHKKP
IYTHAMKKRILQMSKTTPEEYRKSLEAEKAKQQMKSGDENMAPALSTGKT
IPEELNALRPLINSPNKLQTYGYILDPPTEKEIKLSLDGLKSAGGWEQCD
RCTTRFQVYQGRREVDGQLASGGKCIFHWGRLIFLQRTGSAYQDNAREKV
YSCCRRVAGGPGCTTAENHVFKVSEAKRLAASWPFTRTPPPPNPTAGSPP
TDSPESKDSPPTLVEKAICLDCEMCYTTRGMELIRITATAFPTGAIVMDS
LVRPFGEILDLNTRFSGVHPLEFTSAQPFTPQPYPTTTTLINPCSPAPST
PLCIIPSPSAARDLLLTYIDSETPLIGHALENDLNALRLCHKNIIDTAIL
FPHSRGTPARNKLKYLADVHLGRRIQVEGAADGHDSAVDARCAGELVRYK
IGGGLSMR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig140 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00000639001 annotation :

link to GSTUMT00000639001 Artemis file
link to scaffold_206 sequence file
link to scaffold_206ESTs