Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000637001
Length(AA) : 357
Localization : scaffold_206
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : Tmelgs1-like  [+]

Blast Results:

Nr Definition: zinc finger protein gcs1
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001259968.1| Score: 770 E_value: 7e-80
KEGG Definition: ADP-ribosylation factor GTPase activator
Accession: aor:AO090701000265 Score: 760 E_value: 5e-79
KOG Definition: ADP-ribosylation factor GTPase activator
Classification: [Signal transduction mechanisms
Kog Number: KOG0704 Score: 647 E_value: 3e-68
PFAM Definition: ArfGap, Putative GTPase activating protein for Arf. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs..
Pfam Number: pfam01412 Score: 365 E_value: 2e-35
Swissprot: P35197|GCS1_YEAST
Gene Ontology:
GO:0005856 = Cellular component: cytoskeleton
GO:0005768 = Cellular component: endosome
GO:0005793 = Cellular component: ER-Golgi intermediate compartment
GO:0005802 = Cellular component: trans-Golgi network
GO:0003779 = Molecular function: actin binding
GO:0008060 = Molecular function: ARF GTPase activator activity
GO:0042802 = Molecular function: identical protein binding
GO:0030037 = Biological process: actin filament reorganization during cell cycle
GO:0006888 = Biological process: ER to Golgi vesicle-mediated transport
GO:0043001 = Biological process: Golgi to plasma membrane protein transport
GO:0006890 = Biological process: retrograde vesicle-mediated transport
Golgi to ER

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.040NO0.310NO0.059NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0490.1330.931_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.98607First60=1.70967PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000637001
MSKMWEVDPETRRKLLEIQKRDGNNVCCDCNAPAPQWASPKFGIFICLTC
AGVHRGLGVHISFVRSITMDSFKNEEIKRMEKGGNKRCQEFFQKAPEFGD
NMTISERYGSSFGEDYKEKLTADVEGREWVRKERLKASPSLALKGQDNHS
TTSLSSARSGSPASVNASSKERNEAYFSRLGSENANRSTDLLPSQGGKYA
GFGSTPAPDMPAGGNSVPSLDEFSRDPVGALTKGFGLFTTQVSKTAQTVN
QAVIQPTAQKLAEADLAKHAAALGQKVTETGKYGVESLNRFVDNAGGPQY
KPVARGEPEHKDFWDSFGEEKNTPASMVSKKSAATGTMALKSGKKDDHWD
DDNWDKF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6288 zinc finger protein gcs1 [Neosartorya fischeri NRRL 181]2e-77
SY0AAB32YC05FM1 hypothetical protein MGG_01745 [Magnaporthe grisea 70-15]7e-48


Manual Annotation:

Please find below the necessary files for GSTUMT00000637001 annotation :

link to GSTUMT00000637001 Artemis file
link to scaffold_206 sequence file
link to scaffold_206ESTs