Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000632001
Length(AA) : 831
Localization : scaffold_206
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_08739
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001241576.1| Score: 1302 E_value: 1e-141
KEGG Definition: hypothetical protein
Accession: mgr:MGG_11021 Score: 1068 E_value: 1e-114
KOG Definition: AAA+-type ATPase
Classification: [Posttranslational modification
Kog Number: KOG0742 Score: 138 E_value: 8e-09
PFAM Definition: AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes..
Pfam Number: pfam00004 Score: 178 E_value: 2e-13
Swissprot: Q5T9A4|ATD3B_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.052NO0.141NO0.051NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2890.0340.727_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03407First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000632001
MAKAVQTPSTASSPVVGPAQSEGMTEEFPRKLKHVVPFDEDNSPSTFSSS
GHAGSDNERLEEPDCEESLSRDPKMVFHDLDVPDSKPPLNGVNGNSLKLE
SEEKRKKKRVIANGDDKTDTNEIPSVIEMPGPDQSHEVGGMLLDGTMVNC
DSETMDKKERIRSSKLEFKRLDELYNKTTHDFYFAESSPSPAGKEDKWEE
FLFVIRRRFDWQNKYQKTYVDVKSIEIRTVLREVLKDVSGVGLREDKPTV
EPNLLFNYLPQLENELAKAKAVSEEQQNKTLISHLTLFNDYISTDYASTI
KKLYPLLEHYEITFDLLWALFLPNTLIYTICAGSNEPRCLKLDWGEQKET
LDRGKFFQLDCHYVEYDGKTYGEASAVLEIDEFRGARRIDSLGVFPLAYH
EDEEDVRERLIERGRKFGSLKGMHYKYYKGLAFFKRKRGVVRVNVDGRIM
VDPSTFRRINPNYRMSPVKESASHTSPGAANAEDDSENENEDEDEDCGGG
DDEEDEEMTEEQLLLCSPTVLGFSFGDKLWAEFAVEHVNEIEFNPDAFES
LVLPEAQKKIVKALVESHTGNRGSRSGIDDVIKGKGKGLVAVLHGRPGVG
KTLTAEGISEFLQKPLYMVGAGELGTDSRTLETQLSRILDIAHVWGAVLL
LDEADVFLERRSVHDLQRNALVSIFLRLLEYFQGILFLTTNRVETFDEAF
QSRIHIALRYNDLDKKARRVIWKTFLGMVAKEESGPDRALRDVVNDKELE
GLARRELNGRQIKNAVRTAQALALSKNEGLSMEHLKLVLAVTEGFEHDLK
GTGKLDSKDHPLRFADFSQEANLILDMMSYA

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA12YD02FM1 hypothetical protein AN6718.2 [Aspergillus nidulans FGSC A4]3e-19
SY0AAB7YN11FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00000632001 annotation :

link to GSTUMT00000632001 Artemis file
link to scaffold_206 sequence file
link to scaffold_206ESTs