Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000580001
Length(AA) : 2187
Localization : scaffold_207
Number of EST contigs matching the gene: 4
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_06961
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001243065.1| Score: 4637 E_value: 0.0
KEGG Definition: calcium channel subunit Cch1
Accession: afm:AFUA_1G11110 Score: 4473 E_value: 0.0
KOG Definition: Voltage-gated Ca2+ channels
Classification: [
Kog Number: KOG2301 Score: 1623 E_value: 1e-180
PFAM Definition: Ion_trans, Ion transport protein. This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices.
Pfam Number: pfam00520 Score: 293 E_value: 2e-26
Swissprot: O14234|CCH1_SCHPO
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.105NO0.036NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4130.0690.54_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=476.391First60=0.00014PredHel=23
Topology=(364-386,401-423,508-530,567-589,676-693,708-730,768-785,795-817,829-846,856-878,885-907,958-980,1190-1212,1227-1244,1257-1279,1299-1321,1328-1350,1436-1458,1513-1532,1547-1566,1578-1597,1631-1653,1725-1747)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000580001
MASNSRNPSKPPSPEPIPLQDLSRPPDSQQSGSGDTGLSYGVGRSRSLLR
GTTNLGAEIGRRISLHRHRGSYDRVPEERLPPRLEVPDLQLPQYDDGEME
EPNVVEFAEGFVDASGERRGGRSGSWLPPRNLERTISPWAVSDDDEPPPV
RPYYGVGDDDTARLTDPSNVQPMSRSDSSLGHRRQQSSRSMRFGPGPSLG
DDLLSAEEGMNSGVSKMKGGTRSRSGSVAGGTPSRSGSLSKSRSLSPGAS
PVRRVSVAVQNMSQRVVGLSNDPEAVIQGLRRRSSSKSHADGPVRPNIPA
IQIHPQDDIDTSDAEEKPTTPLRRPAPSPGGGPWRVNSNPLRGNTLRIFS
PSNPLRLFLCDVLVHPATEPLILLLILIQTILLAIDAAPSIYEDPRSKSW
GTSNIDYALLVLFSIYTVEIIARCIVSGVFLNPRAENDPKGRGELRRRVM
EGTHKLLSPRRKPSVRAPSPSRLEQPPSLLRSLTSNLQLADRAIPVDGQC
QVRLRMARRAFLRHSFNRLDFVAVVSYWISLWLCITGVEAERHLYVFRMM
SCLRILRLLGITSGTSVILRSLKKAAPLLVNVALLIGFFWLIFAIIGVQS
FKSSFRRSCVWVDPEGVQRNFTQEFQFCGGHRNRLTGLEEPYVYEDGTPG
TRFPKGYICPANSFCVSSNNPYGGTVSFDNIAQSLELVFVVMTANTFSNL
LYYMADSDYLTSALCESLNILYTNLNVVLILIAVITSSFQVIREESRKSA
FAAEEDTSSKVDEEELVRKPNPLKNVYDRTFYVWVTVISVGIFAQAFRSS
NMSRGRETVLGTVELGVTLVLALEILLRFMADWRNFRRKTRNLVDLALAL
ITCIIQIPPIHKSGRIYDWLTLFQILRVYRVVWAIPVTRNLLSKVIGNVS
GLTNLIIFVLLLTFLCAIFAVQIVRGDLPEEYQGDTTAASFHTIFNAFLG
MYQIFSSEDWTTILYMATDVQRPYNVGWITAIFFIGWFILGNFIVLNMFI
AVVQENFDVTEDEKRIYQVKTFLQNKDYSAPSQGISLSNIFGFGKQKTKE
PHSRQAAFEMLTKQAVVESFLDEGAQQPRQPVTRAQPLHAAAEDARRTGD
VKQRPWERMKNRLLGVLGEKEPNPFYSFALSRSIADLTPTAMAQQVVTEQ
ERRRKAQREYLRKYPNYNVPLHIFRSSNPIRRLCQRMVGPSRASIRYDGL
QPYTPFSYAFSILVYCAIVSMVIIACITTPLYQKEYFEKHGSSLRNWFTF
ADAGFVALFTIESLIKIVADGLIWTPNAYLRGSWGVIDCVVLITLWISVI
TSFRNQGEISRAVGAFKALRALRLLNISGAAQNTFHSVVILGGRKILSAA
FVSLSLIIPFAIYGVNLFSGLLDTCNDDSEGIANLTSCVHEYSSTPYDWG
VLAPRAVDNPYFNFDNFGSSLFILFQIVSQEGWTGVMFDVQAIVGKGQQP
RPFSSQANSIFFLAFNLLGAVFVLTLFVSVFMRNYTEQTGVAYLTSDQRS
WLELRKLLRQIRPSRRPKDSPDLDWKSWCYKRATHKHGWWQRTYTVVLVL
HAILLLLEHHPAPPALDRTRDWIFLGFSGIFVGNLVVRVIGLTWSNFLKS
RWDIYAIISVNGTFVTTLLLLAGYQERTFIQLQKLFLVSIVMMLIPRNDD
LDHLFKTAAASLTAIGNLMATWFVLFLVYAIALTQTFGLTRIGPNGNGNM
NFRTVPKALILLFRMTCGEGWNQIMSDFEVSHPNCVYGENFYESDCGSQG
YARALFVSWNILSMYIFVSMFISLIFESFSYVFQRSGGSSVVSRPEIRKF
KQAWQQFDPDGTGYISKENFPRLLGTLTGIFAMRVYEEPFTVPDILDDCR
VDPQSHSSGTTRGIIEGVDLEALNRRVAMIPIHKIRRQRHIYTLFYEECL
VSADKEYGVSFTSVLLILAHYKIINDNRSLRLEEYLRRRYRLQRVEEQVQ
RNIVTNFFLSLYWNKRFKDRHRAHSGAPQVPQIFVDDVSSSRPNTGPNVP
QILVDGGEASLSTSSTSAQLHEGPVTPKRQAPPPLDLDYHVGNSRSPETF
GISSTPQIGDSDPFASPFSAEESPSVLRQRLGRGRSPDVSPSLTPNESPN
MSPNGSPVGSPRLSPIATTSGWISRAGSVSVGGGSPSRSRADSDVVPQNV
LEVLGSSEWGDQIRSYIGRSGDQSSTRSSQGGNAGPR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3775 hypothetical protein HCAG_01795 [Ajellomyces capsulatus NAm1]2e-28
SY0AAD15YH14FM1 No hit found
SY0AAD45YC19FM1 hypothetical protein CIMG_06961 [Coccidioides immitis RS]1e-73
SY0AAD53YB06FM1 hypothetical protein SNOG_07092 [Phaeosphaeria nodorum SN15]5e-77


Manual Annotation:

Please find below the necessary files for GSTUMT00000580001 annotation :

link to GSTUMT00000580001 Artemis file
link to scaffold_207 sequence file
link to scaffold_207ESTs