Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000577001
Length(AA) : 377
Localization : scaffold_207
Number of EST contigs matching the gene: 5
Number of ESTs : 193
  User annotation : TmelCPC1  [+]

Blast Results:

Nr Definition: hypothetical protein MGG_00602
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_368642.2| Score: 312 E_value: 1e-26
KEGG Definition: hypothetical protein
Accession: mgr:MGG_00602 Score: 312 E_value: 5e-27
KOG Definition: Activating transcription factor 4
Classification: [Transcription].
Kog Number: KOG4571 Score: 121 E_value: 3e-07
PFAM Definition: bZIP_1, bZIP transcription factor. The Pfam entry includes the basic region and the leucine zipper region..
Pfam Number: pfam00170 Score: 123 E_value: 2e-07
Swissprot: P11115|CPC1_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.144NO0.349NO0.133NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1370.1620.721_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000577001
MALHNPSPEAFAASTSLRLASTAAPDSQISFDDPVLFPQRAQPSPRTLPN
QLQQSQQQSRTAQPPQPRRVSEIVHGLGYTTTTSSFNHRQASTSYQFTPT
QPQDNSIRTPESRQISQQQQQQPILDPTTAAHYFQTLRQSARAYKMQQEQ
NMKKIDPEAAFEEWFSTDYQGLPSDFSPLTGVHDTSSPSIGPTVSPQELL
MNPPTSTATTNLASPLSLFDSPSESYDTSPLFNGDDVSSDGQWFSLFPET
NPDPEDSVVSPTMPNMPQPDCSGDLPGRLDEEGPDSPSTSPRYRSQSVST
QRRSATSGVRKRAPLPPIVVEDPSDTVAMKRARNTLAARKSRAKKLERME
EMEAQIEELKAEVELWKDRALGHPRRV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig98 No hit found
Contig356 No hit found
Contig4570 No hit found
Contig6705 hypothetical protein SNOG_01521 [Phaeosphaeria nodorum SN15]2e-29
SY0AAB2YN18FM1 hypothetical protein MGG_00602 [Magnaporthe grisea 70-15]5e-11


Manual Annotation:

Please find below the necessary files for GSTUMT00000577001 annotation :

link to GSTUMT00000577001 Artemis file
link to scaffold_207 sequence file
link to scaffold_207ESTs