Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000567001
Length(AA) : 173
Localization : scaffold_201
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: predicted protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001213735.1| Score: 321 E_value: 2e-28
KEGG Definition: UPF0132 domain protein
Accession: afm:AFUA_3G10255 Score: 304 E_value: 9e-27
KOG Definition: No Hit Found
PFAM Definition: UPF0132, Uncharacterised protein family (UPF0132). This is a family of small integral membrane proteins found in some archaebacteria..
Pfam Number: pfam03675 Score: 121 E_value: 1e-07
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.028NO0.050NO0.027NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2020.0270.89_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=46.5776First60=0.00025PredHel=2
Topology=(75-93,110-132)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000567001
MDFAPYQSESPEVSRNFTRPTSPPVRSSYSPLPTPQVPPPVLPTHSSPSG
WGSGGLGRETINQFETSLPIRLDWEAVMAYVLLPPAGGVLLLILEHKSDY
VRFHAWQSSLLFAFLVILHLIFSFSAFLSYSLLVADLGLVGYLGFHAYVD
ADTLDRCEVPFFGPLASSILDDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig188 UV excision repair protein (RadW), putative [Aspergillus clavatus NRRL 1]3e-30
SY0AAA63YE20FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00000567001 annotation :

link to GSTUMT00000567001 Artemis file
link to scaffold_201 sequence file
link to scaffold_201ESTs