Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000554001
Length(AA) : 256
Localization : scaffold_201
Number of EST contigs matching the gene: 4
Number of ESTs : 28
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_13577
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001803784.1| Score: 563 E_value: 4e-56
KEGG Definition: hypothetical protein [EC:6.3.2.19]; K09561 STIP1 homology and U-box containing protein 1
Accession: mgr:MGG_08035 Score: 548 E_value: 1e-54
KOG Definition: Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats)
Classification: [Posttranslational modification
Kog Number: KOG4642 Score: 434 E_value: 9e-44
PFAM Definition: U-box, U-box domain. This domain is related to the Ring finger pfam00097 but lacks the zinc binding residues..
Pfam Number: pfam04564 Score: 235 E_value: 1e-20
Swissprot: Q9UNE7|STUB1_HUMAN
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0031371 = Cellular component: ubiquitin conjugating enzyme complex
GO:0030544 = Molecular function: Hsp70 protein binding
GO:0030191 = Molecular function: Hsp70/Hsc70 protein inhibitor activity
GO:0051879 = Molecular function: Hsp90 protein binding
GO:0030674 = Molecular function: protein binding
bridging
GO:0046332 = Molecular function: SMAD binding
GO:0030911 = Molecular function: TPR domain binding
GO:0004842 = Molecular function: ubiquitin-protein ligase activity
GO:0032436 = Biological process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0031398 = Biological process: positive regulation of protein ubiquitination
GO:0006457 = Biological process: protein folding
GO:0051604 = Biological process: protein maturation
GO:0000209 = Biological process: protein polyubiquitination
GO:0031943 = Biological process: regulation of glucocorticoid metabolic process
GO:0030579 = Biological process: ubiquitin-dependent SMAD protein catabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.018NO0.039NO0.030NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0440.0640.962_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.033First60=0.00289PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000554001
MPMKAEELKNKGNVCYAEGDYVGAEKFYTQAIIKDSTNAAFFTNRALVRL
RMDMYDQVIDDCLKAIDLIPSSLKAYSYLGQAQLKLGYPNEALSSTLRAY
ELAIAQRSPSVGAIAATCLEVKKKRWELSEERRRTRECNLAMRNARLILF
FVPLPGTLEKIQTLEEVFGKAEAERCGKREVPDYLIDNITFSVMLDPVIT
KYGHSYDRVTLLDHLKRSSTDPLTREPLTEKDLRPNLALKAACEAFLKEN
GWAVDW

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1871 hypothetical protein SNOG_13577 [Phaeosphaeria nodorum SN15]5e-63
Contig3517 hypothetical protein SNOG_13577 [Phaeosphaeria nodorum SN15]4e-30
SY0AAA9YI10FM1 No hit found
SY0AAB42YH19FM1 hypothetical protein SNOG_13577 [Phaeosphaeria nodorum SN15]3e-08


Manual Annotation:

Please find below the necessary files for GSTUMT00000554001 annotation :

link to GSTUMT00000554001 Artemis file
link to scaffold_201 sequence file
link to scaffold_201ESTs