Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000508001
Length(AA) : 145
Localization : scaffold_199
Number of EST contigs matching the gene: 3
Number of ESTs : 17
  User annotation : No user annotation

Blast Results:

Nr Definition: sorting nexin-3
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001537818.1| Score: 654 E_value: 3e-67
KEGG Definition: sorting nexin SNX11
Accession: aor:AO090020000309 Score: 651 E_value: 4e-67
KOG Definition: Sorting nexin SNX11
Classification: [Intracellular trafficking
Kog Number: KOG2527 Score: 443 E_value: 4e-45
PFAM Definition: PX, PX domain. PX domains bind to phosphoinositides..
Pfam Number: pfam00787 Score: 270 E_value: 4e-25
Swissprot: Q2U4K2|SNX3_ASPOR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.045NO0.107NO0.037NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1590.0460.852_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.08406First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000508001
MQAPIQSSRAQSFDEIYGPPENFLEIEVKNPQTHGFGRKMYTDYEVVCRT
NIPAFKLKASSVRRRYSDFEHFRDILERESSRVTIPPLPGKVFTNRFSDD
VIEHRREGLQRFLQIVVGHPLLQTGSKVLASFVQDPNWDRTSWSI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2807 sorting nexin-3 [Ajellomyces capsulatus NAm1]1e-66
SY0AAA7YD02FM1 conserved hypothetical protein [Sclerotinia sclerotiorum 1980]3e-61
SY0AAD49YK12FM1 conserved hypothetical protein [Sclerotinia sclerotiorum 1980]3e-67


Manual Annotation:

Please find below the necessary files for GSTUMT00000508001 annotation :

link to GSTUMT00000508001 Artemis file
link to scaffold_199 sequence file
link to scaffold_199ESTs