Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000459001
Length(AA) : 260
Localization : scaffold_197
Number of EST contigs matching the gene: 3
Number of ESTs : 22
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_00344
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001561259.1| Score: 906 E_value: 7e-96
KEGG Definition: hypothetical protein
Accession: ang:An18g06680 Score: 873 E_value: 2e-92
KOG Definition: 20S proteasome
Classification: [
Kog Number: KOG0185 Score: 748 E_value: 4e-80
PFAM Definition: Proteasome, Proteasome A-type and B-type..
Pfam Number: pfam00227 Score: 286 E_value: 1e-26
Swissprot: Q9USQ9|PSB4_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.130NO0.204NO0.086NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2390.0660.759_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.44485First60=0.21205PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000459001
MNHLPEAWGRPRNDVYGTYDASYLQSSMPNQHTQSPIVTGTSVVALKFNG
GVVIAADNLASYGSLARFTNVERLKQVGTHTVVGAGGDISDMQYLHEKLL
DSLIIKEEYQNDGHHLRASHIYRYLSKVLYQRRCKFDPLWNTLLVAGWDD
GKPFLASADLLGTTFSAPALATGFGAHLAVPLLRRVCPDEAAVENITREQ
AVDTIEECMKVLFYRDARSLSKYSLAIITGKDVEGAAECEAKNQSWKFAE
GIRGYGTQVV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3984 hypothetical protein SNOG_03762 [Phaeosphaeria nodorum SN15]4e-06
Contig4598 hypothetical protein SS1G_04067 [Sclerotinia sclerotiorum 1980]3e-79
SY0AAA33YE11FM1 hypothetical protein SS1G_04067 [Sclerotinia sclerotiorum 1980]7e-32


Manual Annotation:

Please find below the necessary files for GSTUMT00000459001 annotation :

link to GSTUMT00000459001 Artemis file
link to scaffold_197 sequence file
link to scaffold_197ESTs