Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000394001
Length(AA) : 223
Localization : scaffold_193
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: pyridoxine
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001260365.1| Score: 674 E_value: 4e-69
KEGG Definition: hypothetical protein [EC:2.6.-.-]; K08681 glutamine amidotransferase
Accession: ani:AN6141.2 Score: 650 E_value: 1e-66
KOG Definition: Imidazoleglycerol-phosphate synthase subunit H-like
Classification: [Coenzyme transport and metabolism].
Kog Number: KOG3210 Score: 462 E_value: 5e-47
PFAM Definition: SNO, SNO glutamine amidotransferase family. This family and its amidotransferase domain was first described in. It is predicted that members of this family are involved in the pyridoxine biosynthetic pathway, based on the proximity and co-regulation of the corresponding genes and physical interaction between the members of pfam01174 and pfam01680..
Pfam Number: pfam01174 Score: 457 E_value: 2e-46
Swissprot: Q8LAD0|PDX2_ARATH
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0004359 = Molecular function: glutaminase activity
GO:0046982 = Molecular function: protein heterodimerization activity
GO:0042819 = Biological process: vitamin B6 biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.149NO0.412NO0.180NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0410.1770.879_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01028First60=0.00743PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000394001
MSGNDSITVGVLALQGAFSEHLELLKKAAEQIETPKKIGFISVKTPVDLE
KCSALIIPGGESTTMALIAERSNILEPLREFVKVHRRPTWGTCAGMILLS
EAANRTKKGGQALIGGLSVRVNRNHFGRQVESFDAPLDLSFLGNDEAPFR
GVFIRAPIVESILPKEECCTNASSIVAVRQGNVVGTSFHPELTGDLRMHK
WWLGEILKDLTRREELLHAQENH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1658 pyridoxine [Aspergillus fumigatus Af293]7e-65


Manual Annotation:

Please find below the necessary files for GSTUMT00000394001 annotation :

link to GSTUMT00000394001 Artemis file
link to scaffold_193 sequence file
link to scaffold_193ESTs