Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000359001
Length(AA) : 742
Localization : scaffold_109
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_03787
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001244346.1| Score: 1439 E_value: 1e-157
KEGG Definition: subunit of cis-Golgi transport vesicle tethering complex - Sec34p
Accession: aor:AO090003000663 Score: 1293 E_value: 1e-140
KOG Definition: Subunit of cis-Golgi transport vesicle tethering complex - Sec34p
Classification: [Intracellular trafficking
Kog Number: KOG2604 Score: 846 E_value: 6e-91
PFAM Definition: Sec34, Sec34-like family. Sec34 and Sec35 form a sub-complex, in a seven protein complex that includes Dor1 (pfam04124). This complex is thought to be important for tether vesicles to the Golgi..
Pfam Number: pfam04136 Score: 207 E_value: 7e-17
Swissprot: Q8CI04|COG3_MOUSE
Gene Ontology:
GO:0017119 = Cellular component: Golgi transport complex
GO:0008565 = Molecular function: protein transporter activity
GO:0006888 = Biological process: ER to Golgi vesicle-mediated transport
GO:0006891 = Biological process: intra-Golgi vesicle-mediated transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.122NO0.144NO0.074NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2830.0250.817_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00539First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000359001
MAGRYFIHTRRPKSRNDLDNLKAERYGRGKGLKARGRGRRATKGPKELED
ELDFADWYGEFEDDLQDANNEHKLFQYTLDSYLTTCNSLISSTDSTLNLL
AELEKSFQTVHSQTSSFQETCSSLLAHRDHIKGLLSSISTNLHPFTELDP
VTRALSRPGSDFVKTPSFREMLVQLDKCLAWMNDPAHRSFHDVENYAPRF
RQNMTRALTLIRNYFVASVREVANEVVGRIKERQMNDTTQSALLYAKFRV
NAPLLRELVGEIERRCDHEDELAATGAPTNKDLVRFSRNGINFVRSICMD
EFELFCAFFSGERSDKCDSNFLETLCEPLYDHLRPRIIHELQLVKLCELC
ALLQTRYMRDPEDPENDSYDRTQLDFGQLIQTTIQDTQNRIVFRAQTVMR
DEIEGFIPKPEDLDYPAKNQSKKKAPENGEVPDSPLPGAPTIIDHDDNPS
GNGFDTEAVFKGWYPALRKCIWLLSRIYRLVNSTVFDDLAHNIVHVTTVS
LLKAHQQIALKQTPADGHLFLIKHLIILKEQIVAFDIEFVHPDVNIDFSV
LTGTFWELREKGIFSSEGIIKLVKGAAMPKVVENMLDAKVELDARLRFAI
NEFTQHFASRMTSGIIGPSNRLAAASATDPAKVVRIAIEREVVVLRRKLE
EYLEDGRTRETLVAAVQEHVIQAYESYYEEIFLRDDSVPPRSPGGTVWDV
EVFVGWSNDIFAVGHGFLAYDGDGAGSEDMSPGMSRAGSLCT

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA53YA01FM1 No hit found
SY0AAB44YD18FM1 hypothetical protein An02g06840 [Aspergillus niger]9e-11


Manual Annotation:

Please find below the necessary files for GSTUMT00000359001 annotation :

link to GSTUMT00000359001 Artemis file
link to scaffold_109 sequence file
link to scaffold_109ESTs