Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000329001
Length(AA) : 678
Localization : scaffold_107
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_01195
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001247424.1| Score: 1309 E_value: 1e-142
KEGG Definition: hypothetical protein
Accession: ang:An11g06960 Score: 1215 E_value: 1e-131
KOG Definition: Putative Xaa-Pro aminopeptidase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG2414 Score: 1182 E_value: 1e-130
PFAM Definition: Peptidase_M24, metallopeptidase family M24..
Pfam Number: pfam00557 Score: 423 E_value: 5e-42
Swissprot: P40051|YEQ8_YEAST
Gene Ontology:
GO:0005759 = Cellular component: mitochondrial matrix
GO:0004222 = Molecular function: metalloendopeptidase activity
GO:0006508 = Biological process: proteolysis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.326NO0.643NO0.219NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2120.0290.806_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.55523First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000329001
MILTTPRTLILRSKEATLRELLVDVAQEIDRDKPGRDRMVLRFVGGWVRD
RLLGLQSVDIDVGIDNMTGYEFATRLDRSRATPKGPSIWRLLFGRLKVRH
NKTPLAATAPSMPSFTTYTLNWMRLCLLSEKRKKKEKGAKISCLHVNLPS
IPRVSLHCILITAMILRRLRTPALRSPSTSVPRRFYSELLQTKFGQPSFE
THPWSLKAGEVTPGISALEYATRRAKLASELPDGAVAVVPAAYVKYRSRP
VFYPFHQNPDFLYLTGFLEPEALCVIEKTGPVGGGEHTFHLFVRGKDSHA
ELWDGPRSGVQAALDVFNADEAGDIKHAEHHLRPILKRASTIYADTISLT
EKPSGFASLITPPPAAAPGSLVQILRDRGVLPLKYFMHKLRVSKSDAEVA
NMRKAGQISGRAFNKAIATKERFTMERDLWAFLEYKFRMGGCEKEAYVPV
IAGGQNSLHIHYTRNDDKLGFVLLCQLVSPVLKDYRESDLVLVDAGGQYG
GYVTDITRTWPVSGTFTPAQRDLYQAVLNVQKRCVSLCCESTCISLDEIH
EVSEMELISELKSLGFDLTSSQLCNVLFPHHVGHYVGLDIHDCGSYSKSR
KLQAGQCVTVEPGVYVPNDLQWPKHFRGMGIRIEDTVCVGDEGPVVLSVE
AVKEVNNHLRLPLLLSRTQPLCSRKSLA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1028 hypothetical protein SS1G_02276 [Sclerotinia sclerotiorum 1980]2e-43


Manual Annotation:

Please find below the necessary files for GSTUMT00000329001 annotation :

link to GSTUMT00000329001 Artemis file
link to scaffold_107 sequence file
link to scaffold_107ESTs