Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000288001
Length(AA) : 564
Localization : scaffold_108
Number of EST contigs matching the gene: 5
Number of ESTs : 567
  User annotation : No user annotation

Blast Results:

Nr Definition: heat shock 70 kDa protein
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248723.1| Score: 2321 E_value: 0.0
KEGG Definition: HEAT SHOCK 70 KD PROTEIN (HSP70)
Accession: ncr:NCU09602.1 Score: 2267 E_value: 0.0
KOG Definition: Molecular chaperones GRP78/BiP/KAR2
Classification: [
Kog Number: KOG0100 Score: 2115 E_value: 0.0
PFAM Definition: HSP70, Hsp70 protein. Hsp70 chaperones help to fold many proteins. Hsp70 assisted folding involves repeated cycles of substrate binding and release. Hsp70 activity is ATP dependent. Hsp70 proteins are made up of two regions: the amino terminus is the ATPase domain and the carboxyl terminus is the substrate binding region..
Pfam Number: pfam00012 Score: 2048 E_value: 0.0
Swissprot: O93866|HSP70_TRIRU

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.030NO0.119NO0.029NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1020.0830.861_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.07703First60=0.00558PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000288001
MKHFPFKIIDKGGKPFIQVEFKGETKVFTPEEISSMVLTKMRETAESYLG
GTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIAYGLD
KKGQGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
LVNHFVQEFKRKHKKDLTSNARALRRLRTACERAKRTLSSSAQTSIEIDS
LYEGIDFYTSITRARFEELCQDLFRSTMEPVERVLRDSKIDKSSVHEIVL
VGGSTRIPKVQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSS
KTQEILLLDVAPLSLGIETAGGVMTPLIKRNTTVPTKKSEVFSTFSDNQP
GVLIQVFEGERARTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIL
NVSAVEKGTGKTNRITITNDKGRLSKEEIERMLAEAEKYKEEDEAEASRI
QAKNGLESYAYSLRNTLSDEKVEEKLDAGDKEKLKSAIDDTVEWLDNNTT
ATKDEFESQQKELEGVANPIMMKFYQSQGGAPPGGMPGAGGFPGAGGAPP
SGGGDDGPQVEEVD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig251 heat shock 70 kDa protein [Coccidioides immitis RS]0.0
Contig1524 heat shock 70 kDa protein [Coccidioides immitis RS]5e-90
SY0AAA27YC19FM1 heat shock 70 kDa protein [Coccidioides immitis RS]9e-94
SY0AAA9YD08FM1 hypothetical protein SNOG_14322 [Phaeosphaeria nodorum SN15]6e-65
SY0AAB1YA02FM1 70 kDa heat shock protein [Trichophyton verrucosum]3e-81


Manual Annotation:

Please find below the necessary files for GSTUMT00000288001 annotation :

link to GSTUMT00000288001 Artemis file
link to scaffold_108 sequence file
link to scaffold_108ESTs