Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000218001
Length(AA) : 514
Localization : scaffold_106
Number of EST contigs matching the gene: 2
Number of ESTs : 20
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_01992
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001792613.1| Score: 432 E_value: 2e-40
KEGG Definition: hypothetical protein
Accession: fgr:FG05167.1 Score: 396 E_value: 1e-36
KOG Definition: Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits
Classification: [Inorganic ion transport and metabolism
Kog Number: KOG1053 Score: 110 E_value: 9e-06
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.284NO0.585NO0.181NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4780.0250.654_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00108First60=0.00075PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000218001
MSMSALRRLSYAMGGGGGGGGDGGAHDEETPRRHHHHHHLHHHHHDKKDY
TISPTGGNVPVRIPSEEEAPHRHRHRRRRASTTPASQEKGRRSPPRVIDP
EFEPKKSHPHKRVAVTFDSPTSSASSITSSGGIEIQGNRRNHGESPPLTP
LIKTTPPTPSPLERARRTNSQRVYRPPPPYPVTPRRDETEYIAFSPANNM
SIPDGPQGRHSDSVAPGKFAPHPGAVEIGSSDSIVQEPKWTDGSSSSAPS
PSHRPSERKAPKPARRPGLSKHRGSIRENQYDFLKTFDTVFVVDDSASMA
GERWDQLGQALETIATIATKYDSDGIDIHFLNSPQYDHEHVTSPASVRDL
FVSVQPAGITPTGACLDRILREYLDKYADAKAAYTPSTSPGPHPTMYASL
PKPLNILVLTDGEPTDDPESVIVAAARNLDRLNAPLHQVGIQFIQIGDEE
GAREALEELDDALEEIYGIRDMVDFTPFVEAPGAGRGERVSGEMILKALL
GAVNRKYDRWGNEF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1083 hypothetical protein SNOG_01992 [Phaeosphaeria nodorum SN15]6e-21
Contig2307 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00000218001 annotation :

link to GSTUMT00000218001 Artemis file
link to scaffold_106 sequence file
link to scaffold_106ESTs