Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000210001
Length(AA) : 471
Localization : scaffold_103
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU03113
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_964972.1| Score: 577 E_value: 2e-57
KEGG Definition: hypothetical protein
Accession: ncr:NCU03113.1 Score: 577 E_value: 1e-57
KOG Definition: Lysophosphatidic acid acyltransferase endophilin/SH3GL
Classification: [
Kog Number: KOG1118 Score: 115 E_value: 2e-06
PFAM Definition: SH3_1, SH3 domain. SH3 (Src homology 3) domains are often indicative of a protein involved in signal transduction related to cytoskeletal organisation. First described in the Src cytoplasmic tyrosine kinase. The structure is a partly opened beta barrel..
Pfam Number: pfam00018 Score: 112 E_value: 4e-06
Swissprot: Q12163|NBP2_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0005515 = Molecular function: protein binding
GO:0006972 = Biological process: hyperosmotic response
GO:0006469 = Biological process: negative regulation of protein kinase activity
GO:0009408 = Biological process: response to heat

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.091NO0.155NO0.084NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.340.060.671_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00021First60=0.00021PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000210001
MSTLSAKGEPFHPQFVSSLSYTSVRDFAYPALHPLHYGPSSATSGLSTPT
DSQRSSQYFDHGSNHGGQAGTWFTGGGSGYRSNHPHHHQPPPLNFSDGPP
WSEDEDLQSPVVVSKHRKHKSSAAHLQTSSQHSRGQSKNAITPTTLQHFA
GNSHGVSGEPGGELYNHPEGDEEYESNNAQQYYQNHHQGGGYRVEGRRPL
DDSRFSRDYQFTIASPDEEMHGKAVALFDFIRENENELPLVEGQVVWVSY
RIGVGWLVAEDPKTGESGLVPEEYVRLLRDLQPLYTPHPESGSPPNPHHD
QESPLILSGSPQPSSRSPSPSSSPQQPPSTSSTSTTSATSTSNNSALNPP
IISTFSTSSQDVHPYPYQFHYPNDHPPAHIRAKSSPDLSGVETPTAGDHK
DRIAQLQREQERAVLEEAEMGGTPRVRTGVGLGLGKGGGGEEVFYDAMER
QHGQQQNSLGELDFREEGRGR

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA60YC20FM1 SH3 domain protein [Aspergillus clavatus NRRL 1]2e-14
SY0AAB31YN05FM1 hypothetical protein SS1G_06016 [Sclerotinia sclerotiorum 1980]9e-26


Manual Annotation:

Please find below the necessary files for GSTUMT00000210001 annotation :

link to GSTUMT00000210001 Artemis file
link to scaffold_103 sequence file
link to scaffold_103ESTs