Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000199001
Length(AA) : 570
Localization : scaffold_103
Number of EST contigs matching the gene: 3
Number of ESTs : 84
  User annotation : Tmelsti1  [+]

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001245032.1| Score: 1624 E_value: 1e-178
KEGG Definition: hypothetical protein
Accession: ang:An12g00790 Score: 1562 E_value: 1e-172
KOG Definition: Molecular co-chaperone STI1
Classification: [Posttranslational modification
Kog Number: KOG0548 Score: 1507 E_value: 1e-167
PFAM Definition: No Hit Found
Swissprot: Q60864|STIP1_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.026NO0.059NO0.040NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0810.0660.928_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000199001
MSSDKLKAEGNAAFSAKDFDKAIGLFTQAIEVDPENHVLFSNRSACYASI
KDFDGALKDAVKCIEIKPDWAKGHTRKGAALHGQGDLAGALETYEDALKL
DPNNPQAKSGVKTIQEAIARDSHQGADLGMGNLFKDPQFLEKLARNPRTS
SYLEDVEFMEKLERIRDDPNLIQTELRDPRIMQVIAALLGLQMEMGDSPG
GPGGASGSFGDTEMPDASGAPPPKKAATPPPEPEDEEAKAKKEAKEAADK
EKALGNENYKKRNFDAAIEHYDRAWELHKDITYLNNLAAAKFEAGDYEGC
IKECERAIEEGREIHADFKLVAKAFGRIGTAHQKLENYPAAIDYYQRSLT
EHRTPEILQKLRAVEKSQADRDRVSYIDPEKAEEAREAGNAYFKSANWPD
AVKSYTEMIKRAPEDPRGYTNRAAALTKLMSFPEAVKDCDEAIKHDPGFM
RAHIRKAQACFAMREYNKCLEACNAATEADTESKHTREIEDLTRKAMQTM
YSAREGETEEQTMERIQKDPEIVAIISDPVMQSILQQAKRDPAALTEHMK
NPVVRGKVQKLMAAGIIRIG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4223 conserved hypothetical protein [Coccidioides immitis RS]1e-178
Contig4737 heat shock protein (Sti1), putative [Neosartorya fischeri NRRL 181]6e-22
SY0AAD21YJ02FM1 hypothetical protein An12g00790 [Aspergillus niger]3e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00000199001 annotation :

link to GSTUMT00000199001 Artemis file
link to scaffold_103 sequence file
link to scaffold_103ESTs