Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000195001
Length(AA) : 665
Localization : scaffold_103
Number of EST contigs matching the gene: 3
Number of ESTs : 16
  User annotation : Tmelugp  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_04242
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001594435.1| Score: 2141 E_value: 0.0
KEGG Definition: conserved hypothetical protein
Accession: fgr:FG00524.1 Score: 2077 E_value: 0.0
KOG Definition: UDP-glucose pyrophosphorylase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG2638 Score: 1948 E_value: 0.0
PFAM Definition: UDPGP, UTP--glucose-1-phosphate uridylyltransferase. This family consists of UTP--glucose-1-phosphate uridylyltransferases, EC:2.7.7.9. Also known as UDP-glucose pyrophosphorylase (UDPGP) and Glucose-1-phosphate uridylyltransferase. UTP--glucose-1-phosphate uridylyltransferase catalyses the interconversion of MgUTP + glucose-1-phosphate and UDP-glucose + MgPPi. UDP-glucose is an important intermediate in mammalian carbohydrate interconversion involved in various metabolic roles depending on tissue type. In Dictyostelium (slime mold) mutants in this enzyme abort the development cycle. Also within the family is UDP-N-acetylglucosamine or AGX1 and two hypothetical proteins from Borrelia burgdorferi the lyme disease spirochaete..
Pfam Number: pfam01704 Score: 1563 E_value: 1e-174
Swissprot: P78811|UGPA1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.355NO0.797NO0.349NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8760.050.075M145

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.15107First60=0.14368PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000195001
MASFTSRWCPVLCFRHPRQACNIPLTLRPPRRSASRSFRPSLSLLHSFLF
SPFLTPISQQANSSSSPALLNNSLCKKAIESTTFHPSSIPLPFLQQEVQE
RTFQALQQEPVDVKPVEAKPIQTVQTVQTVQTATAIPTEQQQPEKMSSFK
KSLPVEGGAPGEGLAPPGRRHGKSQSAFAFDNTSTSVAASQMRNALNGLA
DSVKDPKTKVAFETEMDNFFALFRRYLQDKAKGTTLDWDRIQPPQSSQVI
PYDTLPRVEDPKLLSKLAVLKLNGGLGTSMGCVGPKSVIEVREGMSFLDL
SVRQVEYLNRTYNVDVPFVLMNSFNTDDDTQNIIKKYEGHRVTIHTFNQS
RYPRVLKDSLLPATKDYHSPIVDWYPPGHGDVFESLQNSGILDSLLEKDI
EYLFLSNVDNLGAVVDLSILDHMRETGAEYIMELTDKTKADVKGGTIIDY
EGTVRLLEIAQVPKEHEQDFKSIKKFKYFNTNNIWLNLKAIKRVVENHEL
ELEIIPNSKTIPVDKKGESDISVIQLETAVGAAIRHFKNAHGVNVPRRRF
LPVKTCSDLMLVKSDLYSMKHGQLMMDVARFGPAPLIKLGSHFKKVSDFQ
KRVPSIPRILELDHLTVTGAVNLGRGVTLKGTVIIVANEGSTIDIPPGSV
LENVVVQGSLRLLEH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1066 hypothetical protein SS1G_04242 [Sclerotinia sclerotiorum 1980]0.0
Contig2466 hypothetical protein BC1G_10557 [Botryotinia fuckeliana B05.10]7e-27
Contig5287 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00000195001 annotation :

link to GSTUMT00000195001 Artemis file
link to scaffold_103 sequence file
link to scaffold_103ESTs