Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000150001
Length(AA) : 517
Localization : scaffold_105
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An13g02060
Specie: [Aspergillus niger]
Accession: ref|XP_001396344.1| Score: 715 E_value: 3e-73
KEGG Definition: hypothetical protein
Accession: ang:An13g02060 Score: 715 E_value: 1e-73
KOG Definition: Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies
Classification: [Secondary metabolites biosynthesis
Kog Number: KOG0158 Score: 445 E_value: 1e-44
PFAM Definition: p450, Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the meander, a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyse regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures..
Pfam Number: pfam00067 Score: 522 E_value: 2e-53
Swissprot: Q12612|TRI4_FUSSP

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.428NO0.934YES0.335NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.10.1060.741_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=19.4655First60=18.3905PredHel=1
Topology=(21-43)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000150001
MALDAVIAYARELAPASISRGAIAATVLGVWLLNRIWLVFYRLYLDPLSK
FPGPKLAAATSLYEMYYDIAQDGAFTWKMDELHKKYGPIVRVSPYSLRLR
KSSAYHEVHRMGTPFVKDVRFYGQFKIYNAVFAIIDTELHRQRRALLNPV
FSRKAILDSEPVIKEKLNHLCRRMKEHEVQDKLLNCYTAFVAFTVDVITK
FAYDKSYDILSLPDFDCRIGAAFDSQLEFFLVMKHFPILAQILHSLPISV
INLLMPSGGSFAELELDAKLHLIDLISRMRDGTMKNSTAHRSIFGGILTE
HPDLKADPTELAQEAMSVVAAGVHITRWTLCVGLLEIARDPLIQTKLYEE
LKMARPDINADFSHVQCEKLPYLRGVILEMLRLSYGVVGPLPRRVPKDGA
VVGGYHLPGNSTIEMDSYSIHHDEDIFPDSRRFWPERWLTPESKQKEKFV
TSFGAGPRQCLGINLAMCELYLATATIFRRFEIDISARGPERMKFTEHMV
VVPRDEPLQCKVISRKE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1303 hypothetical protein An02g09420 [Aspergillus niger]4e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00000150001 annotation :

link to GSTUMT00000150001 Artemis file
link to scaffold_105 sequence file
link to scaffold_105ESTs