Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000125001
Length(AA) : 365
Localization : scaffold_104
Number of EST contigs matching the gene: 1
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An17g00210
Specie: [Aspergillus niger]
Accession: ref|XP_001398250.1| Score: 605 E_value: 1e-60
KEGG Definition: hypothetical protein
Accession: ang:An17g00210 Score: 605 E_value: 5e-61
KOG Definition: Predicted oxidoreductase
Classification: [General function prediction only].
Kog Number: KOG2742 Score: 294 E_value: 2e-27
PFAM Definition: GFO_IDH_MocA, Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilise NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot..
Pfam Number: pfam01408 Score: 245 E_value: 1e-21
Swissprot: O13991|YEG9_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.169NO0.492NO0.136NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4280.0790.429_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.70488First60=0.70114PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000125001
MSPRKIAIIGYGFSAKIFHIPFIQHNPNLTISAIIQRNPTPGNDAAKDHP
DVKVYRSVEEFYKSDGESKVVVITTSNDTHFRYCKEAIEKGKDVIVEKPL
TIRSADAEELVNLARKKGVGINVYQNRRFDSDFLTLAKVLPRVGELVSLE
THYDRYRPDTTPNPSKSWKSVQALGNGTLFDLGVHLLDQVVYLFGMPQRI
FGDVRDERGCSVTPSAIWGQEGFVDDFFTATLYYTSTPPRKKPFTVRVEA
STLSCQTPQLRFLLRGVDGSWIKHNLDTQEAQLMSGRIPGTEGFGVEEEE
HFGKLELKDGSVERTVAEVGDYGKFYEKIAEGGVAVPAEEAVRVIRLVEL
IGESSRLGKVLDIAA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig448 hypothetical protein An17g00210 [Aspergillus niger]1e-60


Manual Annotation:

Please find below the necessary files for GSTUMT00000125001 annotation :

link to GSTUMT00000125001 Artemis file
link to scaffold_104 sequence file
link to scaffold_104ESTs