Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000015001
Length(AA) : 592
Localization : scaffold_101
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : TmelFARSB  [+]

Blast Results:

Nr Definition: hypothetical protein An18g03300
Specie: [Aspergillus niger]
Accession: ref|XP_001398790.1| Score: 2252 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An18g03300 Score: 2252 E_value: 0.0
KOG Definition: Phenylalanyl-tRNA synthetase beta subunit
Classification: [Translation
Kog Number: KOG2472 Score: 1900 E_value: 0.0
PFAM Definition: B5, tRNA synthetase B5 domain. This domain is found in phenylalanine-tRNA synthetase beta subunits..
Pfam Number: pfam03484 Score: 177 E_value: 2e-13
Swissprot: O42849|SYFB_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0009328 = Cellular component: phenylalanine-tRNA ligase complex

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.028NO0.105NO0.027NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0520.0860.935_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00403First60=0.00004PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000015001
MPTVSVNKYDLYEALGQQYTTEEFDDLCFEFGIELDEDTENDPDRPKDQP
PQLKIEIPANRYDMLCHEGISLMLNIFREKASIPNYRVVSPPNGEVHQII
VHEETTKIRPYVSAAVLRGIKFTQGRYDSFIALQDKLHQNLCRQRTLVSM
GTHDLDTVKGPFTYEALPPEEIVFAPLNKEEVMNGKQLMEFYENDKHLGR
YLYIIRDSPAYPVILDANRRVCSLPPIINSNLSKITLDTRNIFIEVTATD
RTKAEIVTNILVAMFSQYCDVSFTVEPVKIISPHNNESRQVPNVAPRSTT
AEVSYINSCCGLQLSPSEICTMLDKMAYTAKPSSSDPNLLDIDVPVTRAD
VLHQCDIMEDVAIGYGFNNLPKTFPGKSGTIAAPLPINKLSDIVRLEAAM
CGWSEVLPLILCSHDENFAWLNRKDDGHTAVRLANPKTAEYQIVRTSLLP
GVLKTIRENRKHSLPIKVFEVSDVAFKDEKLERKSRNERHFCAAVCGKTS
GFEAVHGLLDRVMAMLGTKVLDTGEMEQEGYWIEAADEPTHFPGRAASIL
VRHKNGKRQSIGTFGILHPSVLEKFEIPYPVSTLELNLEVFL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1745 hypothetical protein BC1G_10189 [Botryotinia fuckeliana B05.10]1e-82
SY0AAD32YM22FM1 hypothetical protein SS1G_07120 [Sclerotinia sclerotiorum 1980]6e-62


Manual Annotation:

Please find below the necessary files for GSTUMT00000015001 annotation :

link to GSTUMT00000015001 Artemis file
link to scaffold_101 sequence file
link to scaffold_101ESTs