Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010406001
Length(AA) : 642
Localization : scaffold_7
Number of EST contigs matching the gene: 1
Number of ESTs : 3
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: histone deacetylase RpdA
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001265903.1| Score: 1798 E_value: 0.0
KEGG Definition: histone deacetylase RpdA/Rpd3; K06067 histone deacetylase 1/2
Accession: afm:AFUA_2G03390 Score: 1795 E_value: 0.0
KOG Definition: Histone deacetylase complex, catalytic component RPD3
Classification: [Chromatin structure and dynamics].
Kog Number: KOG1342 Score: 1695 E_value: 0.0
PFAM Definition: Hist_deacetyl, Histone deacetylase domain. Histones can be reversibly acetylated on several lysine residues. Regulation of transcription is caused in part by this mechanism. Histone deacetylases catalyse the removal of the acetyl group. Histone deacetylases are related to other proteins..
Pfam Number: pfam00850 Score: 1056 E_value: 1e-115
Swissprot: P32561|RPD3_YEAST
Gene Ontology:
GO:0000508 = Cellular component: Rpd3L complex
GO:0000509 = Cellular component: Rpd3S complex
GO:0004407 = Molecular function: histone deacetylase activity
GO:0003713 = Molecular function: transcription coactivator activity
GO:0003714 = Molecular function: transcription corepressor activity
GO:0000183 = Biological process: chromatin silencing at rDNA
GO:0030466 = Biological process: chromatin silencing at silent mating-type cassette
GO:0006348 = Biological process: chromatin silencing at telomere
GO:0006303 = Biological process: double-strand break repair via nonhomologous end joining
GO:0016575 = Biological process: histone deacetylation
GO:0001308 = Biological process: loss of chromatin silencing during replicative cell aging
GO:0006312 = Biological process: mitotic recombination
GO:0000122 = Biological process: negative regulation of transcription from RNA polymerase II promoter
GO:0010526 = Biological process: negative regulation of transposition
RNA-mediated
GO:0045944 = Biological process: positive regulation of transcription from RNA polymerase II promoter

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.280NO0.635NO0.170NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5050.050.433M518

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01832First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010406001
MKPHRIRMTHSLIMNYRLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSKV
TPDNMEQYSKEQGKYNVGDDCPVFDGLFEFCGISGGGSMEGAARLNRGKC
DIAINWAGGLHHAKKSEASGFCYVNDIVLGIIELLRYKQRVLYIDIDVHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGAGKYYAVNFPLR
DGITDTTYKEVFEPVIGHVMEFYQPDAVVLQCGADSLSGDRLGCFNLSMA
GHANCVEYVKKFNLPTLVVGGGGYTMRNVSRAWTYETGILVNQKVGPNLP
FSDFYEYFGPDYELDVRPSNMENLNSKEYLEKIKIQVLSNLERTRHAPSV
QTTDVGKGLTEHQEEQDAILDDIDEDGPGMDARQTQRQWDRATEKEGELY
SDSEDEEITSSMGVRKTSKKGLRNVRDWKEGGSGTGSGNATPFTGPGGSD
NASESAGGNTAKGSGATSKRDGEGRDLTEFDEELEALRKETEEEVQPDND
GDVEMGDDEQPPPSADALTDEVADEEMTDVPAQSSTSSTKVDPIPTAESL
SQAKPEAATTDDKIRVEASEFSKAETPAKGSGSGVPKPSESSVANAAPEG
SNSMASTTDRHSSKPPLVADESVSSTAKAPANPVEAPAKEEK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4748 hypothetical protein CIMG_04528 [Coccidioides immitis RS]1e-142


Manual Annotation:

Please find below the necessary files for GSTUMT00010406001 annotation :

link to GSTUMT00010406001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs