Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010383001
Length(AA) : 334
Localization : scaffold_7
Number of EST contigs matching the gene: 2
Number of ESTs : 2
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: predicted protein
Specie: [Laccaria bicolor S238N-H82]
Accession: gb|EDR07144.1| Score: 632 E_value: 6e-64
KEGG Definition: ATP dependent DNA ligase domain containing protein [EC:6.5.1.1]; K01971 DNA ligase (ATP)
Accession: tet:TTHERM_00392850 Score: 541 E_value: 1e-53
KOG Definition: ATP-dependent DNA ligase IV
Classification: [Replication, recombination and repair].
Kog Number: KOG0966 Score: 124 E_value: 1e-07
PFAM Definition: DNA_ligase_A_M, ATP dependent DNA ligase domain. This domain belongs to a more diverse superfamily, including pfam01331 and pfam01653..
Pfam Number: pfam01068 Score: 168 E_value: 9e-13
Swissprot: P44121|DNLI_HAEIN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.066NO0.103NO0.049NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0930.0390.918_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010383001
MSEKLDGVRACWDGETFRSREGNPFYAPAWFTKRMPKDITLDGELFTTRG
GFQDCVSIVRTQNKPDAWKFSVTYQIFDIPSMGHKPFEERIAYLKDLFGR
LRIRWVHVLEHTICKGRRHLFDTLDKVTANKGEGLMLREPGSLYINNRSK
TLMKVKRFFDADAIVRGHERGSGKNSNCTGALRVEMLDDNGEPTGKFFKI
GTGLTDKQRQNPPKIGIIVIYRFQELSRDGNPRFPAHMVFVMNKRATRLA
NAENAEESNRMSSKSVEADFRILLKWSKRCAPAELARFRQDERGANYHKG
VFLRIQRCYCGEERCGSTLINNDKLFSPLFIYCL

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB58YP05FM1 No hit found
SY0AAC55YH03FM2 predicted protein [Laccaria bicolor S238N-H82]3e-55


Manual Annotation:

Please find below the necessary files for GSTUMT00010383001 annotation :

link to GSTUMT00010383001 Artemis file
link to scaffold_7 sequence file
link to scaffold_7ESTs