Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007852001
Length(AA) : 776
Localization : scaffold_4
Number of EST contigs matching the gene: 3
Number of ESTs : 3
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CC1G_05516
Specie: [Coprinopsis cinerea okayama7#130]
Accession: gb|EAU82894.1| Score: 2409 E_value: 0.0
KEGG Definition: Alpha amylase, catalytic domain containing protein [EC:3.2.1.1]; K01176 alpha-amylase
Accession: tet:TTHERM_00312180 Score: 1456 E_value: 1e-159
KOG Definition: Alpha-amylase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG2212 Score: 456 E_value: 1e-45
PFAM Definition: Alpha-amylase, Alpha amylase, catalytic domain. Alpha amylase is classified as family 13 of the glycosyl hydrolases. The structure is an 8 stranded alpha/beta barrel containing the active site, interrupted by a ~70 a.a. calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain..
Pfam Number: pfam00128 Score: 322 E_value: 3e-30
Swissprot: Q9BN01|AMYB_DROYA
Gene Ontology:
GO:0004556 = Molecular function: alpha-amylase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.959YES0.992YES0.853YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0610.9510.047S115

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.45907First60=0.02344PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007852001
MFILQLLMFVALAVATPLRKDATQVSLISWTFTDNVLSGSVRIQNIAYRK
VVTVFYAVGSTWSDSQKISATWSVQGTDGYEIWTFSGTATGATQFHIKYD
VSGTSYYDPGNTDNYQVPTTTGAATSTTTIPPTSVGSGTTATPTIPTTTT
TCTGTPVSIGPVDPSIPPAIIPSKIPSEPVPTVPSGCGNWNGLDKCANGV
YTFPDSAERRRWQTPPEGGDGYFKSFQDYRNLVGYADIQYSSDRTRAVVV
VNAASRTGECLKYSFNGVGQSSNTFQVNSGFAGQLEITVTGSDGSSLVLE
PLNFFWQNAPLSAAQSTFSDGQKGGIIELFGWPYDDVAKECAFLGKAGWM
GVKIWPATEHVWGSHYYELDNQFRPWYLSYQPVSYRLHSRMGTRAQLRAM
IQACRTEGVRVYADAVINHMVGQGSDIQNHRVSSCAKYSGRNATDGSPYF
TSGNTYLLSPYTGTRPTLEFPSVPYGPTDFHCERTLNSWTDGQVITKGWL
LGLTDLNTEKPYVQDRIATYLVDLLSIGFTGFRVDAAKHIGPSSVAQILG
RVKAKMGGSMPADWITWLEVIMGGESSLLACSGGEWSWYTNLDNQLKAAG
LSDSEVTKVKVWSSDYPKEMPICGSWIIPASRFAIQNDDHDQQNPGSSSR
DMANKGSVLIKDKDAAKHRGFEVQLFSRTDANWHIKLVLSSYSFMDNGAS
GFPDGHSDCSLYTGNQAISGCLGVPRDTAYVADACSYTISPGKYTRVHRD
LPIINAMRAWVGLGSTTAAALGISGC

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA21YB15FM1 hypothetical protein CC1G_05516 [Coprinopsis cinerea okayama7#130]3e-27
SY0AAA21YJ04FM1 hypothetical protein CC1G_05516 [Coprinopsis cinerea okayama7#130]1e-104
SY0AAA45YG05FM1 hypothetical protein CC1G_08568 [Coprinopsis cinerea okayama7#130]3e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00007852001 annotation :

link to GSTUMT00007852001 Artemis file
link to scaffold_4 sequence file
link to scaffold_4ESTs