Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007799001
Length(AA) : 852
Localization : scaffold_39
No EST evidence
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG06316.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_386492.1| Score: 1784 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: fgr:FG06316.1 Score: 1784 E_value: 0.0
KOG Definition: ATP-dependent DNA ligase I
Classification: [Replication, recombination and repair].
Kog Number: KOG0967 Score: 1552 E_value: 1e-173
PFAM Definition: DNA_ligase_A_M, ATP dependent DNA ligase domain. This domain belongs to a more diverse superfamily, including pfam01331 and pfam01653..
Pfam Number: pfam01068 Score: 413 E_value: 1e-40
Swissprot: P51892|DNL1_XENLA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.030NO0.067NO0.028NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.740.0170.458M489

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01319First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007799001
MASPSKKRKNFSNTQPTRTLHHFFNKQTATKKEALDSVLTPDPQLGPVAL
TDEQYAKRLAEEWKQEDKAIRNATPSTHRESSRAGAKRGRSSSPSTKCAA
SSPHAHSGEEGWKDNLAAATLRASRAVTPVQKPNTPRILQEPKRIAASAE
GALEIERAIDSMPLGEDPLNPEMARRECHLCAPYSRIRPGKFNKVKDKDK
DTLVNFLRILIRLDPDSLLPAVWLTTNDIGPSYETNEFGIDGSIISKAIM
KASGITPATLKKLNNKHGDPGDVAFEAKVKQRTLMMKKPTPLTIENVYAT
LVKISRASGKGSQEIKQRHIERLLVDAKGEEIRYLTRTLIRHLRIGAVKT
TMLIALSRAFSLSAPKGANWNTPEIPGSKEGRQELFTKAEEFLKQCHARR
PNYNDIVPGLLRGGISSLEENCGTSIHSPLKPMLGSITRDLGEMLLKLKG
CEFTCEYKYDGQRAQIHCDDNGKVSVFSRHLELMTGKYPDLVQLVPNIRG
EGVESFIMEGEVVAMDTETGLVKNFQTLAGRERKNVDVGRISVDVCLFAF
DLMYLNGQELLSRPFRERRELLQSIRGYHPGLLPFIVRPKIFTPPASGPP
EGAQELESKQIRSRKGKEAAPVKRSSRVKPLLATYEPDKRLESWPKVKKD
YTAATDTLDLVPIAAWYGNGRKAAWWSPILLALHDPETGSFEAVCKCMSG
FTDKYYIEMKDTLAPDGINTSMTKRAYYEVADSLTPAIWFEPREVWEVAF
ADITVSPTYTAAGQFMEGRGKGLSLRFPRFVRRREDKGVEEASTPEFLAG
LFFKQERDSERISKAAVGGEKKTEGMEQDAEVDGQEFFKNMRGEGAGSDV
NL
Please find below the necessary files for GSTUMT00007799001 annotation :

link to GSTUMT00007799001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs