Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007723001
Length(AA) : 377
Localization : scaffold_39
No EST evidence
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: Histone-lysine N-methyltransferase, H3 lysine-79 specific (Histone H3-K79 methyltransferase) (H3-K79-HMTase) dbj|BAE62919.1| unnamed protein product
Specie: [Aspergillus oryzae]
Accession: sp|Q2U696|DOT1_ASPOR Score: 741 E_value: 2e-76
KEGG Definition: putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1) [EC:2.1.1.43]; K05302 histone-lysine N-methyltransferase
Accession: aor:AO090120000327 Score: 741 E_value: 8e-77
KOG Definition: Putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1)
Classification: [Cell cycle control, cell division, chromosome partitioning, Transcription].
Kog Number: KOG3924 Score: 409 E_value: 1e-40
PFAM Definition: DOT1, Histone methylation protein DOT1. The DOT1 domain regulates gene expression by methylating histone H3. H3 methylation by DOT1 has been shown to be required for the DNA damage checkpoint in yeast..
Pfam Number: pfam08123 Score: 688 E_value: 5e-73
Swissprot: Q2U696|DOT1_ASPOR
Gene Ontology:
GO:0018024 = Molecular function: histone-lysine N-methyltransferase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.037NO0.139NO0.033NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2860.0190.821_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01258First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007723001
MIANMGIREGGKGPSRIFRKTDQKLLSRGISTSDLDSINPRLTAFRYELV
RLAEPDEFSPDLDILSTAEHVATYLLTPPESDKLLTGTLSGSSGGIVYNM
RKAIRNEKAQDFLENLNKYNNLIAKYRRDGTIKANIARMKSLPFPLVEHI
LSQAYARTVAPEVESLKDYEAFTSNVYGELLPNFTTKLFRESGLGLGKVF
VDLGSGTGNVVLHAALETGCEAYGCEIMKNATRLADRQKVEFAARCRMWG
INPGKFRLEKGDFLESARIAEALKRADVVLVNNYVFDSELNQRLLNLFLD
LKEGARILSLKPFVPINHVITTRNAENPVSRLRVEEKEYFSGSVSWTDTG
GKYYVQTVDGSMLREFLASDRSDRRRR
Please find below the necessary files for GSTUMT00007723001 annotation :

link to GSTUMT00007723001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs