Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007703001
Length(AA) : 991
Localization : scaffold_38
Number of EST contigs matching the gene: 3
Number of ESTs : 5
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_09216
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001239595.1| Score: 2599 E_value: 0.0
KEGG Definition: hypothetical protein [EC:6.5.1.1]; K01971 DNA ligase (ATP)
Accession: ani:AN0097.2 Score: 2530 E_value: 0.0
KOG Definition: ATP-dependent DNA ligase IV
Classification: [Replication, recombination and repair].
Kog Number: KOG0966 Score: 1573 E_value: 1e-175
PFAM Definition: DNA_ligase_A_M, ATP dependent DNA ligase domain. This domain belongs to a more diverse superfamily, including pfam01331 and pfam01653..
Pfam Number: pfam01068 Score: 381 E_value: 6e-37
Swissprot: Q1DKE7|DNL4_COCIM

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.016NO0.028NO0.018NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0360.1090.961_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00021First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007703001
MSDIDDIDLPDIPRAPVDPSGDTFGPNVILSDSDLDKAYPNRPRNKNPTL
PFADLYLSLFEPLLANKKKRTGVSIRGTNKVLKPHEIRRNIIDRFISRWR
NEVGNDIYPTLRLILCEKDRDRSVYHLKEKTIGRLLVKVMKINKDSDDGY
SLINWKQPGTSKSAGDFALRCYEIIRKRPMRTTPGSLTISQVNSMLDRLS
LASKEEEQLPIMTEFYNNMNASELMWLIRIIMRQMKVGATERTFFDAWHP
DAAALFNISSSLKRVCWELSDPEFRMDSDGKSVSLMSCFQPQLAQFQKRS
LDDAVKAMHLTPEDPIFWIEEKLDGERMQMHYENGNFMFWSRKAKDYTRL
YGSCFDDGSLTRHLRGAFDDGVKSIILDGEMITWDPRLDCIVAFGTLKTA
ALEGIRNPFGDGPRPLFKVFDILHLNGGCLINYSLRDRRMALERSVKTID
RRMEVHKYEEAREAVEIERALRKVIAEASEGLVIKNPRSIYRLNDRNDDW
MKVKPEYMTEFGESLDLVVLGGYWGSGTRGGILSSYLCGLRVDGNHLKPG
EDPMKFRSFCKVGGGFTANDYSKIAHMTDSQWVPWDPKKPPSEHIEIVAG
GRGVDQPDVWIRPDKSIVLEVKAASIVPTDEFRVGKSLRFPRFRQIREDK
DWQTALSISELIALKEEVEKEKADEEKRIEVENRTRRAGKRMKREYTVLG
ASDKPADFVSPTVEGGPRLFEGRSFYVMSDATTPKKMGKAEVEQLIKSHG
GNLYQTENAVPDTNVIGDKNNVKISALKKKGTHDVIRPAWIFDCIRQHEL
DLQRGQKGCYIIPIEARHILHAASGVERRAAASVDQFGDSYARDLTMEEI
SNLLRDMPGAFDRTFASEFVKGLSEHDQRELGELPGWMFKTFVIYVDREG
QGEVNENLKPSPLLALFAGARIALDLQDTEITHIIASHDQQRLHELREAI
KWRPRIPRIVTRDWLKSSLEARTVLDEEQFSPALGCVTGSA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1001 conserved hypothetical protein [Aspergillus terreus NIH2624]1e-94
Contig5981 hypothetical protein CIMG_09216 [Coccidioides immitis RS]4e-75
SY0AAA34YB04FM1 hypothetical protein AN0097.2 [Aspergillus nidulans FGSC A4]9e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00007703001 annotation :

link to GSTUMT00007703001 Artemis file
link to scaffold_38 sequence file
link to scaffold_38ESTs