Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007613001
Length(AA) : 303
Localization : scaffold_38
Number of EST contigs matching the gene: 1
Number of ESTs : 2
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: translation elongation factor EF-Tu
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001549881.1| Score: 1129 E_value: 1e-121
KEGG Definition: unnamed protein product [EC:3.6.5.3]; K02358 elongation factor EF-Tu
Accession: cgr:CAGL0G09581g Score: 1058 E_value: 1e-113
KOG Definition: Mitochondrial translation elongation factor Tu
Classification: [Translation, ribosomal structure and biogenesis].
Kog Number: KOG0460 Score: 1273 E_value: 1e-141
PFAM Definition: GTP_EFTU_D3, Elongation factor Tu C-terminal domain. Elongation factor Tu consists of three structural domains, this is the third domain. This domain adopts a beta barrel structure. This the third domain is involved in binding to both charged tRNA and binding to EF-Ts pfam00889..
Pfam Number: pfam03143 Score: 312 E_value: 2e-29
Swissprot: P02992|EFTU_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0003924 = Molecular function: GTPase activity
GO:0003746 = Molecular function: translation elongation factor activity
GO:0006414 = Biological process: translational elongation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.066NO0.446NO0.061NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1510.1330.705_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00151First60=0.00017PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007613001
MDGAIIVVAASDGQMPQTREHLLLARQVGVQRIVVFVNKVDALEDAEMLE
LVEMEMRELLSTYGFDGDETPIVMGSALCALEGRRPEIGEQKISELLDAV
DTWIPTPQRDLDKPFLMAIEDVFSIPGRGTVATGRVERGILKRGEEVELV
GYEDVPIKTIVTGLETFKKELDSAQAGDNSGLLLRGIKRDQVRRGMVVVK
PGTTKAHNKFLASLYVLTKEEGGRHTGFHGNYRPQMFLRTSDIPVTIDLP
EGSTDDSHKMIMPGDNLEVQCTIFKPMAVDPGQRFNLREGGRTVATGLVT
RIL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2538 hypothetical protein SS1G_00053 [Sclerotinia sclerotiorum 1980]1e-131


Manual Annotation:

Please find below the necessary files for GSTUMT00007613001 annotation :

link to GSTUMT00007613001 Artemis file
link to scaffold_38 sequence file
link to scaffold_38ESTs