Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007051001
Length(AA) : 201
Localization : scaffold_31
Number of EST contigs matching the gene: 1
Number of ESTs : 247
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_12441
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001802664.1| Score: 772 E_value: 1e-80
KEGG Definition: alanine aminotransferase [EC:2.6.1.2]; K00814 alanine transaminase
Accession: aor:AO090003000164 Score: 761 E_value: 1e-79
KOG Definition: Alanine aminotransferase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0258 Score: 668 E_value: 5e-71
PFAM Definition: No Hit Found
Swissprot: P52893|ALAM_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.042NO0.123NO0.043NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0760.1110.874_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03703First60=0.01544PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007051001
MQKASPGVYDEVELVSFQSVSKGMVGECGHRGAYFELVGFDQEVQAQIYK
LISIGICPPVIGQCLVEMMVNPPAPGSPSYQLYQQEYSSIFQSLVLRSRA
LHEAFVRMEGVECQDPLGAMYLFPTITIPTAAVEKAQEEGRRPDEYYCMR
LLEATGICVTPGSGFGQREGEWHFRTTFLAPGVDWVARLEKFHEGFMNEF
R

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig5325 hypothetical protein BC1G_04300 [Botryotinia fuckeliana B05.10]1e-180


Manual Annotation:

Please find below the necessary files for GSTUMT00007051001 annotation :

link to GSTUMT00007051001 Artemis file
link to scaffold_31 sequence file
link to scaffold_31ESTs