Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00006511001
Length(AA) : 892
Localization : scaffold_27
Number of EST contigs matching the gene: 2
Number of ESTs : 4
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: SET and WW domain protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001273933.1| Score: 1483 E_value: 1e-162
KEGG Definition: hypothetical protein
Accession: ani:AN8825.2 Score: 1474 E_value: 1e-161
KOG Definition: Clathrin coat binding protein/Huntingtin interacting protein HIP1, involved in regulation of endocytosis
Classification: [Intracellular trafficking, secretion, and vesicular transport].
Kog Number: KOG4442 Score: 1038 E_value: 1e-113
PFAM Definition: SET, SET domain. SET domains are protein lysine methyltransferase enzymes. SET domains appear to be protein-protein interaction domains. It has been demonstrated that SET domains mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). A subset of SET domains have been called PR domains. These domains are divergent in sequence from other SET domains, but also appear to mediate protein-protein interaction. The SET domain consists of two regions known as SET-N and SET-C. SET-C forms an unusual and conserved knot-like structure of probably functional importance. Additionally to SET-N and SET-C, an insert region (SET-I) and flanking regions of high structural variability form part of the overall structure..
Pfam Number: pfam00856 Score: 328 E_value: 8e-31
Swissprot: Q1DU03|SET2_COCIM
Gene Ontology:
GO:0018024 = Molecular function: histone-lysine N-methyltransferase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.032NO0.102NO0.035NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2740.0310.801_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00011First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00006511001
MLAGTINGSPSPGSEGVRNIHLSDSPRCGSAGVGRHSRVTVPDELKMRAS
RGSSKASSRGNTPSSQGSEVSVKQGNGTPPRKSQRAAPQKSARKPPTLFT
DYPDSTQEAISTFSVIDECIYSTKSIGDSGQDGEVMSCECRTDWDGECNP
ACGDNSDCINRMTSMECTQDDRACGQDCQNQRFQQRQYADVSVIKTEKKG
FGLRANSDISINTFLYEYVGEVIDENKFRRRMEKYDSEGIKHFYFMSLGK
NEFIDATKKGGLARFCNHSCNPNCFIDKWVVGEKLRMGIFAKRNVKAGEE
LVFDYNVDRYGAEPQTCYCGEFNCLGYIGGKTQTDGAAPKLSHHIIEALG
LEDSEEWSTATAKKGRRLKKTDGDDEDYVESVQSKPLGEADVTKVMSSLL
HCKEKWIVSKLLHRIQLSEDEAVPARVVKMHGYQIMGKILHDYQSDENIV
LMALDILMKFPRITKNKITSSKIEPTVQQLSTADDQRVQEASKALLEVWS
SLETGFRIPRRSKADMERTRSMYQAYERESSSKSKSNSPQLEKPLTPNGP
SRPRPFTKSGFQNQPPRGPRAEQFQRHNDKPRRDIPWGWHKTHTGDGKLY
YYSNDGRARWDIPQEPSLQAIIDGITRSRSTEKMNKQEQERLKEEERVRQ
AEKEADSKRAKEMLKEKEKAQREAEKIKPPKIYDNEKTKKILIRAFSTVV
ANAVNKYESEIGGRDLVKKHAKDITELLVKKEMKDGRQIANPHLLLESDS
KRLKVKGFVKPYIEKVIRNKQSMDNRKREKQKASSSSHRPESSSSSEKNK
EVASESSFIPPAAISPMADGVETSIGTPMAGTTPLATPGKRRRDEIGEAS
GNPDVVAENEGGDPKRPRPSPPKDVTPPPPPTGVTEVTFSSS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig5666 No hit found
SY0AAB15YD07FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00006511001 annotation :

link to GSTUMT00006511001 Artemis file
link to scaffold_27 sequence file
link to scaffold_27ESTs